LOADING...
   YP_001297591.1;GS13522A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001297591.1    PDB Fold Similairty





PDB sequences with significant alignments
Sequence information                                           Score	E-value
JCSG3209156|pdb|3S30_A|Hypothetical glycoside hydrolase           728	0.0
JCSG2990728|pdb|3HBZ_A|putative glycoside hydrolase               303	1e-82
JCSG3256984|pdb|4HET_A|HYPOTHETICAL GLYCOSIDE HYDROLASE           228	7e-60
JCSG3264495|pdb|4JRL_A|putative glycoside hydrolase               227	1e-59
PDB sequence alignments
QUERY       18  TSCIKDEAPNAEADILNCILPAEMLTGTDIDYNRPYDKSLNAYPIYIEVNNGTDLTRLAP 77
JCSG3209156 2   ------------ADILNCILPAEMLTGTDIDYNRPYDKSLNAYPIYIEVNNGTDLTRLAP 49
JCSG2990728 2   ----REEAPNAEADILSCrLPGvVMTtSpIitNN----SINiF-----VGpGTDISsLAP 48
JCSG3256984 3   TSCIQDEAlNSEAaIdaCtgddvQLANiNaD-----SKlINVY-----VNKGADLSKqkl 52
JCSG3264495 2   ----QDEAlNSEAaIdvCsgddvQLANiDaD-----SKvINVY-----VNKGADLSKqkl 47

QUERY       78  TFELTEGASI---E---PANGSTQ------NF------TNPVRYTVTSEDKNWHRTYAIN 119
JCSG3209156 50  TFELTEGASI---E---PANGSTQ------NF------TNPVRYTVTSEDKNWHRTYAIN 91
JCSG2990728 49  eFtLTpGATI---D---PpSGTAR------DF------hSPqQYTVTAaDgfWkKkYTVS 90
JCSG3256984 53  eFvIpEGATIkinD---qVaGDTEatydfsEe------THsrKFTVTSEDgQWkpVYTVK 103
JCSG3264495 48  eFtLpQGATI---KvntPiTGDTE------StydfseepHsrKFTVTSEDgQWQpVYTVN 98

QUERY       120 IHYPETKSIPTVFNFENVKTVPYNKNEYYVLYEAASGY--S-----TLTWSSGNQGFALT 172
JCSG3209156 92  IHYPETKSIPTVFNFENVKTVPYNKNEYYVLYEAASGY--S-----TLTWSSGNQGFALT 144
JCSG2990728 91  VidtE---LaTIYNFEDT----lGgQKYYIFvEreGek--v-----VMeWASGNaGYAMT 136
JCSG3256984 104 VvlaE---LPTsFNFEELlp----SNDYdIFYEfqpGt--SqeiskVLqWSSGNpGFkLT 154
JCSG3264495 99  VilaE---LPTLFKFEELlTTssEyDtFYeFtpATSqeisK-----VLqWSSGNpGFkLT 150

QUERY       173 GSGYTPNDFPTSISPNGRTGNCLQLITRKTGSLGTLVGMPIAAGNLFIGSFDIGSAMSDA 232
JCSG3209156 145 GSGYTPNDFPTSISPNGRTGNCLQLITRKTGSLGTLVGMPIAAGNLFIGSFDIGSAMSDA 204
JCSG2990728 137 GvpkTaDDYPTfqfaNGKTGKCLSLVTRSTGfFGSIMGMPIAAGNLFIGSFDVGNAMSNp 196
JCSG3256984 155 GmAnSkTDYPTvqvaNGfrGKgVKLeTRdTGSFGAMVkMyIAAGNLFIGTFEVGNALTDp 214
JCSG3264495 151 GmAnSriDYPTvqvaNGfkGKAVKLeTRNTGDFGAMVkMyIAAGNLFIGTFEVeNALTNp 210

QUERY       233 LSATKFGTTFYYEPIKLVGYYKYKAGPEFYENGE-S-TNRKDVFNIYALFYEKTKDVQML 290
JCSG3209156 205 LSATKFGTTFYYEPIKLVGYYKYKAGPEFYENGE-S-TNRKDVFNIYALFYEKTKDVQML 262
JCSG2990728 197 LKATKFGlpFrHiPtyLAGYYKYKAGdQFtEGGK-pvSGKRDIcDIYAIMYEtSESVptL 255
JCSG3256984 215 rKATNFGfqFYkRPktLkGHYKFKAGdvYsvEGKpQ-eGvRDkcDIYAVMYEaeNNsvML 273
JCSG3264495 211 rKATNFGfqFYkHPIaLkGYYKFKAGevYsvEGQpQ-TGKRDkcDIYAVMYEaeNNsiML 269

QUERY       291 DGHIAKNNYEHENMVAAAVI--TDTHETSEWTRFELDFNYEHYGKTIDPQKLANGGYNVS 348
JCSG3209156 263 DGHIAKNNYEHENMVAAAVI--TDTHETSEWTRFELDFNYEHYGKTIDPQKLANGGYNVS 320
JCSG2990728 256 DG---tNaFtspNLVSiArI--dDAkETDEWTyFKLpFHmls-GKyIDkEKLTaGkYNVA 309
JCSG3256984 274 NG---dDvFtsDKLVSlArIkpeDVvESDQWTdFEIpFE-pvkGRVIDdtKLkNGkYKLG 329
JCSG3264495 270 NG---dNvFNsDKLVllArIepeDivESDEWNEFtIhFE-SvkGReIDdtKLqNGkYKLG 325

QUERY       349 IVLSASKDGDVFQGAPGSTLLIDDLELVCKQPLR 382
JCSG3209156 321 IVLSASKDGDVFQGAPGSTLLIDDLELVCKQPLR 354
JCSG2990728 310 IVFTSSlEGDhFNGAiGSTLLIDEVELI------ 337
JCSG3256984 330 IVLSSSvDGayFKGAvGSTLyVDEVELICE---- 359
JCSG3264495 326 IVLSSSvDGayFRGAvGSTLyVDELELICKE--- 356

Note
Homologous search is done using BLAST from NCBI BLAST against database pdbnr with expect (E-value cut-off) at 0.001. The structure of a PDB sequence may be fully or partly solved. The non-redundant database pdbnr consists of unique PDB sequences from the representative PDB chains. Each representative chain has the best structural coverage in the set of the same sequences. You could click a sequence ID to see all of PDB chains associated with the sequence ID plus sequence alignments and structural coverages.



Contact Webmaster JCSG Menu