|
YP_001050848.1;PC06938B |
Protein Sequence Comparative Analysis (PSCA) | |
 |
||
|
YP_001050848.1 PDB Fold Similairty  PDB sequences with significant alignments Sequence information Score E-value JCSG1661289|pdb|2RA9_A|Uncharacterized protein DUF1285 305 5e-84 JCSG1661137|pdb|2RE3_A|Uncharacterized protein 56 9e-09PDB sequence alignments QUERY 9 QHTLKQFAADSALTTTTPLCSEVPLFDINALGDWTYLGTSL--PAKFAKLFASILHCIDD 66 JCSG1661289 2 QHTLKQFAADSALTTTTPLCSEVPLFDINALGDWTYLGTSL--PAKFAKLFASILHCIDD 59 JCSG1661137 49 -------------------------------GtWfYqGTpInrPA-MVRLFSSILkreED 76 QUERY 67 EYFLITPVEKVRVQVEDAPLLIVDFERAQP--HSLLNVSTSIGTLHHNVDIKQMKLTDD- 123 JCSG1661289 60 EYFLITPVEKVRVQVEDAPLLIVDFERAQP--HSLLNVSTSIGTLHHNVDIKQMKLTDD- 116 JCSG1661137 77 RFYLVTPVEKVgIRVDDAPFVaVDvEvAgqgrkQVLTfTThVGdsavagEgNpIRMAQDp 136 QUERY 124 -----SVYLPLERGLWGKLGRACYYNFVNEFNLSDLNEQ 157 JCSG1661289 117 -----SVYLPLERGLWGKLGRACYYNFVNEFNLSDLNEQ 150 JCSG1661137 137 atgepApYVhVRaGLeAlIdRksFYRLMDlgEIED---- 171 Note Homologous search is done using BLAST from NCBI BLAST against database pdbnr with expect (E-value cut-off) at 0.001. The structure of a PDB sequence may be fully or partly solved. The non-redundant database pdbnr consists of unique PDB sequences from the representative PDB chains. Each representative chain has the best structural coverage in the set of the same sequences. You could click a sequence ID to see all of PDB chains associated with the sequence ID plus sequence alignments and structural coverages. |
