LOADING...
   TM1526;TM1526
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1526    PDB Fold Similairty





PDB sequences with significant alignments
Sequence information                                           Score	E-value
JCSG442264|pdb|1VJX_A|Putative Ferritin-Like Diiron-Carbox...     278	1e-75
PDB sequence alignments
QUERY      2   KVSDILTVAIRLEEEGERFYRELSEHFNGEIKKTFLELADQERIHAEIFRKMSDQENWDE 61
JCSG442264 14  KVSDILTVAIRLEEEGERFYRELSEHFNGEIKKTFLELADQERIHAEIFRKxSDQENWDE 73

QUERY      62  VDSYLAGYAFYEVFPDTSEILRRKDLTLKEVLDIAISVEKDSIILYYELKDGLVNSDAQK 121
JCSG442264 74  VDSYLAGYAFYEVFPDTSEILRRKDLTLKEVLDIAISVEKDSIILYYELKDGLVNSDAQK 133

QUERY      122 TVKKIIDQEKEHLRKLLEMKREST 145
JCSG442264 134 TVKKIIDQEKEHLRKLLExKREST 157

Note
Homologous search is done using BLAST from NCBI BLAST against database pdbnr with expect (E-value cut-off) at 0.001. The structure of a PDB sequence may be fully or partly solved. The non-redundant database pdbnr consists of unique PDB sequences from the representative PDB chains. Each representative chain has the best structural coverage in the set of the same sequences. You could click a sequence ID to see all of PDB chains associated with the sequence ID plus sequence alignments and structural coverages.



Contact Webmaster JCSG Menu