LOADING...
   TM1394;TM1394
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1394    PDB Fold Similairty





PDB sequences with significant alignments
Sequence information                                           Score	E-value
JCSG470898|pdb|1VQ0_A|33 kDa chaperonin                           570	e-163
JCSG457512|pdb|1VZY_A|33 KDA CHAPERONIN                           211	3e-55
JCSG216661|pdb|1I7F_A|Heat Shock Protein 33                       85	6e-17
JCSG216491|pdb|1HW7_A|HEAT SHOCK PROTEIN HSP33                    71	1e-12
JCSG3194645|pdb|3M7M_X|33 kDa chaperonin                          62	6e-10
JCSG457310|pdb|1XJH_A|33 kDa chaperonin                           42	5e-04
PDB sequence alignments
QUERY       1   MIYYGTMFDHKVRFSIVRMREVVEEARNRHALSYLATVVLGRALIGAALVTPWLAEKERW 60
JCSG470898  13  MIYYGTMFDHKVRFSIVRMREVVEEARNRHALSYLATVVLGRALIGAALVTPWLAEKERW 72
JCSG457512  10  -------YDgKVRayaARttDMVNEGQRRHGtwptASAALGRTMtASlMLgamLkgdDKl 62
JCSG216661  17  -----------VRgELVtVsETLQQilENHdypqpVknVLAElLVATSLLTatLkfdgdi 65
JCSG216491  19  -----------VRgELVtVsETLQQilENHdypqpVknVLAElLVATSLLTatLkfdgdi 67
JCSG3194645 19  -----------VRgELVtVsETLQQilENHdypqpVknVLAElLVATSLLTatLkfdgdi 67
JCSG457310      ------------------------------------------------------------

QUERY       61  TLDIEGNGPIRRVVAQSTSEFTVRGYVANPKVELPLNEKGKFDVAGAIG-QGVLRVVRDL 119
JCSG470898  73  TLDIEGNGPIRRVVAQSTSEFTVRGYVANPKVELPLNEKGKFDVAGAIG-QGVLRVVRDL 131
JCSG457512  63  TVkIEGGGPIgaIVADANAKgeVRAYVSNPQVHFdLNaaGKLDVrrAVGtNGTLsVVKDL 122
JCSG216661  66  TVQLQGDGPxNlAViNGNNNqqxRG-VARvQgEIPeNa----DLktlVG-NGyVvITitp 119
JCSG216491  68  TVQLQGDGPMNlAViNGNNNqqMRG-VARvQgEIPeNa----DLktlVG-NGyVvITitp 121
JCSG3194645 68  TVQLQGDGPMNlAViNGNNNqqMRG-VARvQgEIPeNa----DLktlVG-NGyVvITitp 121
JCSG457310      ------------------------------------------------------------

QUERY       120 GLKTPFVSQVPLVSGEIAEDLAYYFAVSEQIPSAFSIGVLVDSDG-VKIAGGFAVQIIDR 178
JCSG470898  132 GLKTPFVSQVPLVSGEIAEDLAYYFAVSEQIPSAFSIGVLVDSDG-VKIAGGFAVQIIDR 190
JCSG457512  123 GLRefFTGQVeIVSGELGDDFTYYLVsSEQVPSSvGVGVLVNpDNtIlaAGGFiIQLMpg 182
JCSG216661  120 SegerYqGvVgLeGdtLAaDLedYFXrSEQLPTrLfIrT-gDvDG-kpaAGGxlLQVxpa 177
JCSG216491  122 SegerYqGvVgLeGdtLAacLedYFmrSEQLPTrLfIrT-gDvDG-kpaAGGMlLQVMpa 179
JCSG3194645 122 SegerYqGvVgLeGdtLAaDLedYFmrSEELPTrLfIrT-gDvDG-kpaAGGMlLQVMpa 179
JCSG457310      ------------------------------------------------------------

QUERY       179 TLEQEKVEMIEKNIKNLPSISKLFQEA-EPL-----DVLERIF-GEK-VGFVETAEIKYK 230
JCSG470898  191 TLEQEKVEMIEKNIKNLPSISKLFQEA-EPL-----DVLERIF-GEK-VGFVETAEIKYK 242
JCSG457512  183 T-DDEtItkIEQRLSQVepISKLIQKGltPe-----EILEEVL-GEK-peILETmpVRFh 234
JCSG216661  178 qnaQQd------DFdHLaTLTEtIKte-ElLtlpanEVLwRLY-hEEeVtvyDpqDVEFK 229
JCSG216491  180 qnaQ------QdDFdHLaTLTEtIKte-ElLtlpanEVLwRLYheEE-VtvyDpqDVEFK 231
JCSG3194645 180 qnaQ------QdDFdHLaTLTEtIKte-ElLtlpanEVLwRLYheEE-VtvyDpqDVEFK 231
JCSG457310  2   -------------------------------------------------------DVEFK 6

QUERY       231 CDCNREKAKNALLVLDKKELED-M-RKEGKGEVVCKWCNTRYVFSEEELEELLKFKVDDS 288
JCSG470898  243 CDCNREKAKNALLVLDKKELED-M-RKEGKGEVVCKWCNTRYVFSEEELEELLKFKVDDS 300
JCSG457512  235 CpCSKERfETAILgLgKKEIQD-MiEEDGQAEAVChFCNeKYLFTKEELEgL-------- 285
JCSG216661  230 CtCSRERSaDALkTLpdEEVDSiL-aEDGEiDxhCdYCGNHYLFNamDIaEI-------- 280
JCSG216491  232 CtCSRERCaDALkTLpdEEVDS-I------------------------------------ 254
JCSG3194645 232 CtCS-------------------------------------------------------- 235
JCSG457310  7   CtCSRERCaDALkTLpdEEVDSiL-aEDGEiDMhCdYCGNHYLFNamDIaEI-------- 57

QUERY       289 GS 290
JCSG470898  301 GS 302
JCSG457512  284 -- 285
JCSG216661  279 -- 280
JCSG216491  253 -- 254
JCSG3194645 234 -- 235
JCSG457310  56  -- 57

Note
Homologous search is done using BLAST from NCBI BLAST against database pdbnr with expect (E-value cut-off) at 0.001. The structure of a PDB sequence may be fully or partly solved. The non-redundant database pdbnr consists of unique PDB sequences from the representative PDB chains. Each representative chain has the best structural coverage in the set of the same sequences. You could click a sequence ID to see all of PDB chains associated with the sequence ID plus sequence alignments and structural coverages.



Contact Webmaster JCSG Menu