LOADING...
   TM1158;TM1158
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1158    PDB Fold Similairty





PDB sequences with significant alignments
Sequence information                                           Score	E-value
JCSG296201|pdb|1O1Y_A|Conserved Hypothetical Protein Tm1158       441	e-124
JCSG3159250|pdb|3M3P_A|Glutamine amido transferase                84	6e-17
JCSG425101|pdb|3L7N_A|Putative uncharacterized protein            70	1e-12
JCSG1529601|pdb|2D7J_A|GMP synthase [glutamine-hydrolyzing]...    54	1e-07
JCSG470396|pdb|1WL8_A|Gmp Synthase [Glutamine-Hydrolyzing]...     53	1e-07
JCSG494610|pdb|2YWB_A|GMP synthase [glutamine-hydrolyzing]        46	2e-05
JCSG493178|pdb|2A9V_D|Gmp Synthase                                45	5e-05
JCSG2875254|pdb|2VXO_B|GMP SYNTHASE [GLUTAMINE-HYDROLYZING]       42	3e-04
JCSG1673436|pdb|2VPI_A|GMP SYNTHASE                               42	3e-04
PDB sequence alignments
QUERY       1   MRVLAIRHVEIEDLGMMEDIFREKNWSFDYLDTPKGEKLERPLEEYSLVVLLGGYMGAYE 60
JCSG296201  13  VRVLAIRHVEIEDLGxxEDIFREKNWSFDYLDTPKGEKLERPLEEYSLVVLLGGYxGAYE 72
JCSG3159250 6   --VMiIQfsasEgpGhFgDFLagEHipFQvLrmdRSDpLpaeIRDcSgLAMMGGpMSAnD 63
JCSG425101  37  ------------------------------------EKLpKdIDDFDMLILMGGpQSpsS 60
JCSG1529601     ------------------------------------------------------------
JCSG470396      ------------------------------------------------------------
JCSG494610      ------------------------------------------------------------
JCSG493178      ------------------------------------------------------------
JCSG2875254 73  ---------------------------------------------FraIIIsGGpnSVYa 87
JCSG1673436 68  ---------------------------------------------FraIIIsGGpnSVYa 82

QUERY       61  EEK-YPFL--KYEFQLIEEILKKEIPFLGICLGSQMLAKVLGASVYRGKNGEEIGWY--F 115
JCSG296201  73  EEK-YPFL--KYEFQLIEEILKKEIPFLGIxLGSQxLAKVLGASVYRGKNGEEIGWY--F 127
JCSG3159250 64  D---lPWM--ptlLaLIRDaVaQRVPvIGhCLGGQLLAKAMGGEVtdSpHAE-IGWvraW 117
JCSG425101  61  tKKeFPYydaQaEvKLIQKaaKSEkiIVGVCLGAQLMGvAyGAD-YlhSpkKEIGnY--L 117
JCSG1529601 83  --------------KVLEHydEfNVPILGICLGhQLIAKfFGGKVgRGEKA-EySlv--e 125
JCSG470396  63  --------------KVLEHydEfNVPILGICLGhQLIAKfFGGKVgRGEKA-EySlv--e 105
JCSG494610  72  ------------------------LPLLGICyGmQLLAQeLGGrVeRAgRA-EyGka--L 104
JCSG493178  87  -------------------------PILGICVGAQFIAlhFGASVvKAKH-pEFGkt--k 118
JCSG2875254 88  EDa-pwFd--paiFtIgK-------PvLGICyGmQMMnKVFGGTVHK-KSvREdGvF--n 134
JCSG1673436 83  EDa-pwFd--paiFtIgK-------PvLGICyGmQMMnKVFGGTVHK-KSvREdGvF--n 129

QUERY       116 VEKVSDNK---FFREFPDRLRVFQWHGD-TF-DLPRRATRVFTSEKYENQGFV--Y---- 164
JCSG296201  128 VEKVSDNK---FFREFPDRLRVFQWHGD-TF-DLPRRATRVFTSEKYENQGFV--Y---- 176
JCSG3159250 118 pQhVpQal---eWlgtwDELELFEWHyQ-TF-SIPpgAVHILrSEhcaNQAYV--l---- 166
JCSG425101  118 ISlTEaGKmdsYLsDFsDdLlVgHWHGD-mp-gLPdKAqvLaiSQgcpRQiIk--F---- 169
JCSG1529601 126 IEiIDEDE---IFKgLPkRLKVWEsHmD-evkELPpKfkiLarSEtcpiEAMk--H---- 175
JCSG470396  106 IEiIDExE---IFKgLPkRLKVWEsHmD-evkELPpKfkiLarSEtxpiEAMk--H---- 155
JCSG494610  105 LtR-hEGp---LFRgLegEVQVWMsHqD-Av-taPppGwRV-VAEteENpvaA--iaspd 155
JCSG493178  119 VSvxhSEN---IFggLPSEItVWEnHNDeiI-NLPddfTlAaSSatcQvQGFy--Hkt-- 170
JCSG2875254 135 ISvdNtcS---LFRgLqkEevVLltHGD-Sv-DkvadGfKVvArSgnivaGIAnes---- 185
JCSG1673436 130 ISvdNtcS---LFRgLqkEevVLltHGD-Sv-DkvadGfKVvArSgnivaGIAnes---- 180

QUERY       165 G-K--A-VGLQFHIEV-----GARTMKRWIE--AYKDELEKKKIDPRLLLETAER----E 209
JCSG296201  177 G-K--A-VGLQFHIEV-----GARTxKRWIE--AYKDELEKKKIDPRLLLETAER----E 221
JCSG3159250 167 d-d--lhIGFQcHIEM-----qAHmVREWcS--ispEELK-------------------- 196
JCSG425101  170 GpK--q-yAFQcHLEf-----tpElVaalI---AqEDDLDtQS-QtEtyVQTAEEmqtfD 217
JCSG1529601 176 e-Elpi-yGVQFHpEV-------------------------------------------- 189
JCSG470396  156 e-Elpi-yGVQFHpEV-------------------------------------------- 169
JCSG494610  156 G-R--A-yGVQFHpEVahtpkGmQiLENFLElaGvKrDwtpEhVleELLrEVrER----a 207
JCSG493178  171 r-p--i-yAtQFHpEV-------------------------------------------- 182
JCSG2875254 186 k-K--l-yGaQFHpEV-----G-------------------------------------- 198
JCSG1673436 181 k-K--l-yGaQFHpEV-----G-------------------------------------- 193

QUERY       210 EKVLKGLLRSLLERMVES 227
JCSG296201  222 EKVLKGLLRSLLERxVES 239
JCSG3159250 195 ------------------ 196
JCSG425101  218 ySsMNqaLySFLDRLTE- 234
JCSG1529601 188 ------------------ 189
JCSG470396  168 ------------------ 169
JCSG494610  208 gK---------------- 209
JCSG493178  181 ------------------ 182
JCSG2875254 197 ------------------ 198
JCSG1673436 192 ------------------ 193

Note
Homologous search is done using BLAST from NCBI BLAST against database pdbnr with expect (E-value cut-off) at 0.001. The structure of a PDB sequence may be fully or partly solved. The non-redundant database pdbnr consists of unique PDB sequences from the representative PDB chains. Each representative chain has the best structural coverage in the set of the same sequences. You could click a sequence ID to see all of PDB chains associated with the sequence ID plus sequence alignments and structural coverages.



Contact Webmaster JCSG Menu