LOADING...
   TM0828;TM0828
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0828    PDB Fold Similairty





PDB sequences with significant alignments
Sequence information                                           Score	E-value
JCSG975591|pdb|2AJR_A|Sugar Kinase, Pfkb Family                   612	e-175
JCSG975099|pdb|2F02_A|Tagatose-6-Phosphate Kinase                 128	4e-30
JCSG1559095|pdb|2Q5R_A|Tagatose-6-phosphate kinase                119	2e-27
JCSG1538943|pdb|2JG5_A|FRUCTOSE 1-PHOSPHATE KINASE                119	2e-27
JCSG1559094|pdb|2JG1_A|TAGATOSE-6-PHOSPHATE KINASE                119	3e-27
JCSG493188|pdb|2ABQ_A|Fructose 1-Phosphate Kinase                 112	3e-25
JCSG3192931|pdb|3Q1Y_A|Lin2199 protein                            88	7e-18
JCSG2997805|pdb|3IE7_A|Lin2199 protein                            87	2e-17
JCSG3257921|pdb|3UQE_A|6-phosphofructokinase isozyme 2            71	1e-12
JCSG109831|pdb|3CQD_B|6-phosphofructokinase isozyme 2             70	1e-12
PDB sequence alignments
QUERY       1   MVLTVTLNPALDREIFIEDFQVNRLYRINDLSKTQMSPGGKGINVSIALSKLGVPSVATG 60
JCSG975591  14  -VLTVTLNPALDREIFIEDFQVNRLYRINDLSKTQxSPGGKGINVSIALSKLGVPSVATG 72
JCSG975099  3   LIVTVTxNPSIDiSyLLDhLKLDtVnRtSQVTKT---PGGKGLNVTrVIhdLGgdvIATG 59
JCSG1559095 21  MILTLTLNPSVDiSypLtaLKLDdVnRVQEVSKTa---GGKGLNVTrVLAQVGePvLASG 77
JCSG1538943 1   MIyTVTFNPSIDyvIFtNDFKIDgL---NraTaTykfaGGKGINVSrVLKtLdVeSTAlG 57
JCSG1559094 21  MILTLTLNPSVDiSypLtaLKLDdVnRVQEVSKTa---GGKGLNVTrVLAQVGePvLASG 77
JCSG493188  2   -IyTVTLNPSIDyiVqVENFQqGv---VNrsERdRkQPGGKGINVSrVLKRLGheTkAlG 57
JCSG3192931 3   LIyTITLNPAIDRlLFIRgeleKR--KtNrViKTEFDcGGKGLHVSgVLSKFGIkNeAlG 60
JCSG2997805 3   LIyTITLNPAIDRlLFIRgeleKR--KtNrViKTEFDcGGKGLHVSgVLSKFGIkNeAlG 60
JCSG3257921 4   -IyTLTLaPSLDsatItpQIDpEgklRc---TapvFEPGGgGINVArAIAhLGgsATAif 59
JCSG109831  4   -IyTLTLaPSLDsatItpQIypEgklRc---TapvFEPGGgGINVArAIAhLGgsATAif 59

QUERY       61  FVGGYMGKILVEELRKISKLITTNFVYVEG-ETRENIEIIDEKNKTITAINFPGPDVTDM 119
JCSG975591  73  FVGGYxGKILVEELRKISKLITTNFVYVEG-ETRENIEIIDEKNKTITAINFPGPDVTDx 131
JCSG975099  60  vLGGFhGaFIANELKKaN--IpqaFTsIKe-ETRDSIaILhEgNQT--eIleaGPtVSpe 114
JCSG1559095 78  FIGGeLGQFIAKKLdhaD--IkhaFynIKG-ETRNcIaILhEgQQT--eIleqGPEIdNQ 132
JCSG1538943 58  FAGGFpGKFIIDtLN--NSaIqSNFIeVDe-DTRiNVKL---KTgqeTeINaPGPhITSt 111
JCSG1559094 78  FIGGeLGQFIAKKLdhaD--IkhaFynIKG-ETRNcIaILhEgQQT--eIleqGPEIdNQ 132
JCSG493188  58  FLGGFtGayVrNaLEK--EeIglSFIeVEG-DTRiNVKI---KGKqeTeLNgtAPlIkke 111
JCSG3192931 61  IAGSdnldkLyaiLKE--KhINhDFLveaGtSTREcFvVLSDdTNgsTmIpeaGftVSQt 118
JCSG2997805 61  IAGSdnldkLyaiLKE--KhINhDFLveaGtSTREcFvVLSDdTNgsTmIpeaGftVSQt 118
JCSG3257921 60  pAGGatGEhLVSlLadeNvpVAT--VeAKd-wTRQNLHVhvEaSgeqyrFvMPGaaLNEd 116
JCSG109831  60  pAGGatGEhLVSlLadeNvpVAT--VeAKd-wTRQNLHVhvEaSgeqyrFvMPGaaLNEd 116

QUERY       120 DVNHFLRRYKMTLSKVDCVVISGSIPPGVNEGICNELVRLARERGVFVFVEQTPRLLERI 179
JCSG975591  132 DVNHFLRRYKxTLSKVDCVVISGSIPPGVNEGICNELVRLARERGVFVFVEQTPRLLERI 191
JCSG975099  115 EISNFLENFdQlIKQAEiVTISGSLakGLpSdFyQELVQkAHaQeVkVLLDtSgdsLRQV 174
JCSG1559095 133 EAagFIKHFEQlLEKVEAVAISGSLPkGLNQdyyaQIIErCQNKGVpVILDcSgatLQtV 192
JCSG1538943 112 QfEQLLQQiKnTtSE-DiVIVAGSVPsSIpSdayaQIAQITaQtGAkLvVDaekELaEsV 170
JCSG1559094 133 EAagFIKHFEQmMEKVEAVAISGSLPkGLNQdyyaQIIErCQNKGVpVILDcSgatLQtV 192
JCSG493188  112 hVQaLLEQl-teLEKgDvLVLAGSVPqAxpQtIyRSxTQIAKERGAFVaVDtSgEaLHEV 170
JCSG3192931 119 NkDNLLKQiakkVKKeDmVVIAGSpPPhyTlSdfKELLRtVKatGAFLgcDNSgEyLNla 178
JCSG2997805 119 NkDNLLKQiakkVKKeDmVVIAGSpPPhyTlSdfKELLRtVKatGAFLgcDNSgEyLNla 178
JCSG3257921 117 EfRQ-LEEqvLeIESgaiLVISGSLPPGVKleklTQLIsaAQKQGIrcIVDSSgEaLSaa 175
JCSG109831  117 EfRQ-LEEqvLeIESgaiLVISGSLPPGVKleklTQLIsaAQKQGIrcIVDSSgEaLSaa 175

QUERY       180 YE-GPEFPNVVKPDLRGNH---ASFLGVDLKTFDDYVK--LAEKL-AE--KSQVSVVSYE 230
JCSG975591  192 YE-GPEFPNVVKPDLRGNH---ASFLGVDLKTFDDYVK--LAEKL-AE--KSQVSVVSYE 242
JCSG975099  175 lQ-GPwkPyLIKPNLE-El---eGLLGqDFS--ENpLa--aVQta-lt--KpxfAgIEWi 222
JCSG1559095 193 lE-NPykPTVIKPNIselY----QLLNqpLdeslEsLKqaVSQpL-fE--giEwiIVSlg 244
JCSG1538943 171 l---PyhPlfIKPNkdelE---VmF-NTtVNSdaDvIK--yGRlL-VD--KGaqSVIvsl 218
JCSG1559094 193 lE-NPykPTVIKPNIselY----QLLNqpLdeslEsLKqaVSQpL-fE--giEwiIVSlg 244
JCSG493188  171 la-Ak--PSfIKP----NHhelSELVSkpIaSIEDaIp--hVQRLiGE--giEsiLVSFa 219
JCSG3192931 179 vEmGvDF---IKP----NE---dEvIAIldEktNSleE--niRtL-AE--KipylVVSlg 223
JCSG2997805 179 vEmGvDF---IKP----NE---dEvIAIldEktNSleE--niRtL-AE--KipylVVSlg 223
JCSG3257921 176 la-igNI-ELVKPNqK-El---SALVNrELtqpDDvrK--aAQEI-VNsgKAKrvVVSlg 226
JCSG109831  176 la-igNI-ELVKPNqK-El---SALVNrELtqpDDvrK--aAQEI-VNsgKAKrvVVSlg 226

QUERY       231 V----KNDIVATREGVWLI---RSKEEIDTSHLLGAGDAYVAGMVYYFIKHGANFLEMAK 283
JCSG975591  243 V----KNDIVATREGVWLI---RSKEEIDTSHLLGAGDAYVAGxVYYFIKHGANFLExAK 295
JCSG975099  223 VislgKDgaIAkHHdqFyr---vKiptIQAKNpVGSGDAtIAGLAYgLaK-dApaaELlK 278
JCSG1559095 245 A----QGaFAkhNHtfYrV----NiptISVlNpVGSGDStVAGITsaILNH--------- 287
JCSG1538943 219 g----gDgaIyidKeIsIk---avNpQgkVvNtVGSGDStVAGMV--------------- 256
JCSG1559094 245 A----QGaFAkhNHtfYrV----NiptISVlNpVGSGDStVAGITsaILNH--------- 287
JCSG493188  220 g----dGaLfASaEGxFhV---NvpSg-EVrNsVGAGDSvVAGFL-aaLQEGkSLeDaVp 270
JCSG3192931 224 A----KGSIcAhNgkLYqVippKvQERnDT----GAGDVFV-GafiagLamNmpItEtlK 274
JCSG2997805 224 A----KGSIcAhNgkLYqVippKvQERnDT----GAGDVFVGAFI--------------- 260
JCSG3257921 227 p----QGaLgVdsENciqV----vpppVkSQstVGAGDSmVGAMTlk-LaENASLeEMVR 277
JCSG109831  227 p----QGaLgVdsENciqV----vpppVkSQstVGAGDSmVGAMTlk-LaENASLeEMVR 277

QUERY       284 FGFASALAATRRKEKYMPDLEAIKKEYDHFTVERVK 319
JCSG975591  296 FGFASALAATRRKEKYxPDLEAIKKEYDHFTVERVK 331
JCSG975099  279 WGxAAGxAnAQERxtghvDVEnVKKHlxNIqVvEI- 313
JCSG1559095 286 ------------------------------------ 287
JCSG1538943 255 ------------------------------------ 256
JCSG1559094 286 ------------------------------------ 287
JCSG493188  271 FAvAAGsA---------------------------- 278
JCSG3192931 275 vAtGcSaSAVmQQDSssfDLEAagK----------- 299
JCSG2997805 259 ------------------------------------ 260
JCSG3257921 278 FGvAAGsAAT-------------------------- 287
JCSG109831  278 FGvAAGsAAT-------------------------- 287

Note
Homologous search is done using BLAST from NCBI BLAST against database pdbnr with expect (E-value cut-off) at 0.001. The structure of a PDB sequence may be fully or partly solved. The non-redundant database pdbnr consists of unique PDB sequences from the representative PDB chains. Each representative chain has the best structural coverage in the set of the same sequences. You could click a sequence ID to see all of PDB chains associated with the sequence ID plus sequence alignments and structural coverages.



Contact Webmaster JCSG Menu