LOADING...
   TM0018;TM0018
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0018    PDB Fold Similairty





PDB sequences with significant alignments
Sequence information                                           Score	E-value
JCSG211212|pdb|1B0P_A|PROTEIN (PYRUVATE-FERREDOXIN OXIDORE...     100	2e-21
PDB sequence alignments
QUERY      106  KKYAFIAFGGDGGTYDIGLQSLSGMLERGHKVLYVLYDNEGYMNTGNQRSGSTPPGSDTT 165
JCSG211212 953  KKsVWI-FGGDGwAYDIGygGLDhVLasGEdVnvfVmDTEvYsNTGGQsSkATPtGAvAk 1011

QUERY      166  TAPVGKKLPGKVQLKKNIVEIVAAHENVYAATASLSEPMDFFAKV-EKALNFDGPSFLAV 224
JCSG211212 1012 fAaAGKRtg-----KKDLARMVmTYgyVYVATVSMGyskQqFlKVlKEAeSFpGPSLViA 1066

QUERY      225  FSPCV-RFWRVNDDKTVEISKLAVETKYWPLYEVERGVYRVTRKPRQFK------PVEEF 277
JCSG211212 1067 YAtCInQglRkGmgKSqDVmNtAVKSgYWPLFRyDprLaaqgKNPfQLdskapdgsVEEF 1126

QUERY      278  LKAQGRFRKL-LSRP-DAKEIVDELQEYVDRRWERL 311
JCSG211212 1127 LmAQNRFavLdrSfPeDAKRLraQVaHeLDvRFKEL 1162

Note
Homologous search is done using BLAST from NCBI BLAST against database pdbnr with expect (E-value cut-off) at 0.001. The structure of a PDB sequence may be fully or partly solved. The non-redundant database pdbnr consists of unique PDB sequences from the representative PDB chains. Each representative chain has the best structural coverage in the set of the same sequences. You could click a sequence ID to see all of PDB chains associated with the sequence ID plus sequence alignments and structural coverages.



Contact Webmaster JCSG Menu