LOADING...
   YP_001337146.1;SP18574A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001337146.1    PDB Fold Similairty





PDB sequences with significant alignments
Sequence information                                           Score	E-value
JCSG3303883|pdb|4XVV_A|Acid stress chaperone HdeB                 163	2e-41
JCSG3211705|pdb|2XUV_B|HDEB                                       74	2e-14
PDB sequence alignments
QUERY       26  VEETTPQNMTCQEFMDMNPKSMTPVAFWVVNRNTDFSGGDYVDWHEVETVSVPKMLQECH 85
JCSG3303883 2   VEETTPQNMTCQEFMDMNPKSMTPVAFWVVNRNTDFSGGDYVDWHEVETVSVPKMLQECH 61
JCSG3211705 6   ------KDMTCQEFIDLNPKAMTPVAWWMLHEETvYKGGDtVtlNETDlTQIPKVIEyCk 59

QUERY       86  KNPAAKLGDLSAVIKK 101
JCSG3303883 62  KNPAAKLGDLSAVIKK 77
JCSG3211705 60  KNPqkNL--------- 66

Note
Homologous search is done using BLAST from NCBI BLAST against database pdbnr with expect (E-value cut-off) at 0.001. The structure of a PDB sequence may be fully or partly solved. The non-redundant database pdbnr consists of unique PDB sequences from the representative PDB chains. Each representative chain has the best structural coverage in the set of the same sequences. You could click a sequence ID to see all of PDB chains associated with the sequence ID plus sequence alignments and structural coverages.



Contact Webmaster JCSG Menu