LOADING...
   NP_904517.1;C.KN20883A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_904517.1    PDB Fold Similairty





PDB sequences with significant alignments
Sequence information                                           Score	E-value
JCSG3302047|pdb|4RDB_A|Immunoreactive 32 kDa antigen PG49         612	e-175
PDB sequence alignments
QUERY       30  DRSIEISIRVDDFTKTGEAVRYERNQGSAAERLITNLYLLLFDQSGANPAKYYITGNTFT 89
JCSG3302047 2   DRSIEISIRVDDFTKTGEAVRYERNQGSAAERLITNLYLLLFDQSGANPAKYYITGNTFT 61

QUERY       90  GGTWLPDDMKVKLDMTQSEAGERKVYVVANVDNAVKTALDAVANESDLQTVKRTTAMPWS 149
JCSG3302047 62  GGTWLPDDMKVKLDMTQSEAGERKVYVVANVDNAVKTALDAVANESDLQTVKRTTAMPWS 121

QUERY       150 TDIASPFLMSGNKTHDFLANRLLDNVPLVRAIAKVELNISLSEKFQIVPIIVNGSLSEFK 209
JCSG3302047 122 TDIASPFLMSGNKTHDFLANRLLDNVPLVRAIAKVELNISLSEKFQIVPIIVNGSLSEFK 181

QUERY       210 FRYVNFDKETYVVKPTTKPDNLISSANGVWPQITDWTVWGASLNTSPAPDAGTGYTLDAN 269
JCSG3302047 182 FRYVNFDKETYVVKPTTKPDNLISSANGVWPQITDWTVWGASLNTSPAPDAGTGYTLDAN 241

QUERY       270 GKVTALRIVTYLNERDSKGATVEVALPRVDDGTLPPPEFGPELYRLPLPDKILRNHWYKY 329
JCSG3302047 242 GKVTALRIVTYLNERDSKGATVEVALPRVDDGTLPPPEFGPELYRLPLPDKILRNHWYKY 301

QUERY       330 EVEI 333
JCSG3302047 302 EVEI 305

Note
Homologous search is done using BLAST from NCBI BLAST against database pdbnr with expect (E-value cut-off) at 0.001. The structure of a PDB sequence may be fully or partly solved. The non-redundant database pdbnr consists of unique PDB sequences from the representative PDB chains. Each representative chain has the best structural coverage in the set of the same sequences. You could click a sequence ID to see all of PDB chains associated with the sequence ID plus sequence alignments and structural coverages.



Contact Webmaster JCSG Menu