LOADING...
   NP_812419.1;SP15308D
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_812419.1    PDB Fold Similairty





PDB sequences with significant alignments
Sequence information                                           Score	E-value
JCSG3298231|pdb|4QNI_A|Uncharacterized protein                    680	0.0
JCSG3172983|pdb|3NQK_A|uncharacterized protein                    249	2e-66
JCSG3186356|pdb|3P02_A|Uncharacterized protein                    212	3e-55
PDB sequence alignments
QUERY       22  SEWEDEQYEHYISFSSQL--DSKGVTNIYVPYSRHDAEGNYAEGGEGRSNYQLPILVSGS 79
JCSG3298231 2   SEWEDEQYEHYISFSSQL--DSKGVTNIYVPYSRHDAEGNYAEGGEGRSNYQLPILVSGS 59
JCSG3172983 2   NEWEDEQYEQYVSFKApIasgSdGVTTIYVrYKdN-----------GKvTYQLPIIVSGS 50
JCSG3186356 3   -EWtDEQFKQlISFKTQp--gGwGVTDVHVrYAN-----------SAKyTYNLPVLVSGS 48

QUERY       80  TDNPSNVTVHVAHDADTLNILNYARYAT-RTELYYEDMGAEGLAYASYPESLQIKAGENK 138
JCSG3298231 60  TDNPSNVTVHVAHDADTLNILNYARYAT-RTELYYEDMGAEGLAYASYPESLQIKAGENK 118
JCSG3172983 51  TvNsQDrdIHIAvDkDTLKtLNieRFSlyRpELWYtEMeeDky---EFPETVHIpAGScv 107
JCSG3186356 49  TDNtDDrlVsfSlrdDTLDILNFeKFGN-RpELYFRELpqK---YySFPKELtIpAGQSh 104

QUERY       139 GLLDLKFDFRNIDMSEKWVLPLQIVDDASYNYVAHPRKDYAKAILRIFPFNDYSGDYSGT 198
JCSG3298231 119 GLLDLKFDFRNIDMSEKWVLPLQIVDDASYNYVAHPRKDYAKAILRIFPFNDYSGDYSGT 178
JCSG3172983 108 eLLNIdFNLQDIDMlEKWVLPLtIVDDGSYaYqSHPRKNYAKALLKVvPFNNYSGSYTAS 167
JCSG3186356 105 ALLpIEFSLdGLDdSQKWALPLKVcEDANgTYAVNPRKyYrtAVLRpIlFNEFSGrFSGS 164

QUERY       199 GITNKVVTGYDGDGKPIETAESITKSSIRGYVIDEQTIFTYAGIVDEDYTD--RRKYKIK 256
JCSG3298231 179 GITNKVVTGYDGDGKPIETAESITKSSIRGYVIDEQTIFTYAGIVDEDYTD--RRKYKIK 236
JCSG3172983 168 SM--KVyTyi--NGKPdtNARTtdKrT--GYVVDNNSIFfYAGLINEDmdkdmRKKYKIN 221
JCSG3186356 165 SLlGtMAg---------ESdiKFSSTEIKlnVVtDSiVFfYAGqrtEDYeD--RiNYKVf 213

QUERY       257 FAFNGETNGS------VTISCDN-AEEIGFELNKDVTPSFRISSSMDDAKPYLEHRYVII 309
JCSG3298231 237 FAFNGETNGS------VTISCDN-AEEIGFELNKDVTPSFRISSSMDDAKPYLEHRYVII 289
JCSG3172983 222 vhF--KeDGT------LdMKqDDpSNEMeFELig--TPTYssTSvMDaTRPYLERRYVqI 271
JCSG3186356 214 LqFTGDkvdSkkdlykMkIwAEN-eK---LKFNSysTPTYKVSSEMDaTKtYLKHtYIVI 269

QUERY       310 ----NNVDYYF-NYIPVEGTIIRYHVKGTLTLSRDINTQIPDEDQAIEW 353
JCSG3298231 290 ----NNVDYYF-NYIPVEGTIIRYHVKGTLTLSRDINTQIPDEDQAIEW 333
JCSG3172983 272 mfeyDfqDFtY-GgsgTEvipIKYRVaGSMTLlRNINTQIPDEDQqIEW 319
JCSG3186356 270 ----SDIDFdFvDYtsVpNyeIEYNMKGgLSVSRDLDTRkPDEDQ---- 310

Note
Homologous search is done using BLAST from NCBI BLAST against database pdbnr with expect (E-value cut-off) at 0.001. The structure of a PDB sequence may be fully or partly solved. The non-redundant database pdbnr consists of unique PDB sequences from the representative PDB chains. Each representative chain has the best structural coverage in the set of the same sequences. You could click a sequence ID to see all of PDB chains associated with the sequence ID plus sequence alignments and structural coverages.



Contact Webmaster JCSG Menu