LOADING...
   NP_811570.1;C.KN13462A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_811570.1    PDB Fold Similairty





PDB sequences with significant alignments
Sequence information                                           Score	E-value
JCSG3296593|pdb|4QDG_B|Putative adhesin                           635	0.0
JCSG2987310|pdb|3GF8_A|putative polysaccharide binding prot...    155	3e-38
JCSG3187774|pdb|3PAY_D|putative adhesin                           99	5e-21
PDB sequence alignments
QUERY       27  SSCERIYEDLAPCPHGVSLRFIYDYNMEYANAFAKKVDCLTLLVYDENGNYVDTRIVTGT 86
JCSG3296593 2   ---ERIYEDLAPCPHGVSLRFIYDYNMEYANAFAKKVDCLTLLVYDENGNYVDTRIVTGT 58
JCSG2987310 2   ASCDsFnEDLpeCr--LSVKFkYDYNMEFADAFhaQVDkVeLyVFDKNGKYLfkQaeeGS 59
JCSG3187774 2   -SCDsIrEDLprCe--LwLEFVFDYNMEYADAFnpQVksVdVLVFDSDdKlLfTKsVkvA 58

QUERY       87  ELQDENYRMKL--DLKQGNYHFVAYGGLACNKSSFLMKYTPGEG--TGYTDLQ---VELD 139
JCSG3296593 59  ELQDENYRMKL--DLKQGNYHFVAYGGLACNKSSFLMKYTPGEG--TGYTDLQ---VELD 111
JCSG2987310 60  aLStgNYlMEV--ELpvGQYQFMAWAG--ARdSydItSlTPGvS--T-lTDLK---LKLk 109
JCSG3187774 59  aLvggN-RMSLtdELdfGSYkvLTvGSLS---DrFrLSdNaGNklvpGtTtLQqviVSLk 114

QUERY       140 SECLTNPRRKNLHGLYWGELT----LATAD--LYSEGTVEMMKNTNNIRVVLQQMNGE-P 192
JCSG3296593 112 SECLTNPRRKNLHGLYWGELT----LATAD--LYSEGTVEMMKNTNNIRVVLQQMNGE-P 164
JCSG2987310 110 rEA-SliiNKRMEtLWYGEVi----nVNfDgtVHQteTINLIRDTKiVRfgFQSyTGSwt 164
JCSG3187774 115 rE--TGgvNfEFQhLYFGEVVevdhLpSnt--nHKiypVNLIRDTNRFNLALMgyEeN-k 169

QUERY       193 VDDKKFEFEI-TDDNILFSYDNNLLENGMVTYTPWAQGQASAGFTDEGREVVVAYAELST 251
JCSG3296593 165 VDDKKFEFEI-TDDNILFSYDNNLLENGMVTYTPWAQGQASAGFTDEGREVVVAYAELST 223
JCSG2987310 165 LDmNdYDYEI-iESNghLGHDNSLLDDdVLSFrPYyM---------EqKDpATAYVDMNT 214
JCSG3187774 170 VDgtQYtFEIqApENaVYSWENEptgQGpITYVPYytGpGEi-------SdVVmsARLNT 222

QUERY       252 SRLMVRDWYSPKLTVRRKADGVEIINIPLINYLLMLKS-DLY--ASMDSQEFLDRESEWS 308
JCSG3296593 224 SRLMVRDWYSPKLTVRRKADGVEIINIPLINYLLMLKS-DLY--ASMDSQEFLDRESEWS 280
JCSG2987310 215 mRLM--EdrKtRLVLtEKASGkRVFDInLIDYLaMtNA-E-g--kNLSTQEYLDRQSNYh 268
JCSG3187774 223 mRLLnRSgWDyKFiIRdanteAEVwSynLMTlLsIaRpvSrYdgTELpfQEYLDRQSEWN 282

QUERY       309 MIFFLSPNLEWIKTYIKINDWTVRINDIRQ 338
JCSG3296593 281 MIFFLSPNLEWIKTYIKINDWTVRINDIRQ 310
JCSG2987310 269 IIFFLSeS--WLaVqIvVNgWVhRIQEeNQ 296
JCSG3187774 283 LVF--------------------------- 285

Note
Homologous search is done using BLAST from NCBI BLAST against database pdbnr with expect (E-value cut-off) at 0.001. The structure of a PDB sequence may be fully or partly solved. The non-redundant database pdbnr consists of unique PDB sequences from the representative PDB chains. Each representative chain has the best structural coverage in the set of the same sequences. You could click a sequence ID to see all of PDB chains associated with the sequence ID plus sequence alignments and structural coverages.



Contact Webmaster JCSG Menu