LOADING...
   NP_810851.1;FR15002A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_810851.1    PDB Fold Similairty





PDB sequences with significant alignments
Sequence information                                           Score	E-value
JCSG3294847|pdb|4Q1Z_A|Putative lipoprotein                       824	0.0
PDB sequence alignments
QUERY       1   MSGTAEVNPITVDVYLDITVENISTLKDLTVKFDNYDEDLHYVKEVTDNSVKVDGIIPGI 60
JCSG3294847 2   MSGTAEVNPITVDVYLDITVENISTLKDLTVKFDNYDEDLHYVKEVTDNSVKVDGIIPGI 61

QUERY       61  YSVTVSGTAIDTENNEYYINGNSVNAALFKHGSALNIEVQGLKVSPLIFKEIYYCGSRPE 120
JCSG3294847 62  YSVTVSGTAIDTENNEYYINGNSVNAALFKHGSALNIEVQGLKVSPLIFKEIYYCGSRPE 121

QUERY       121 KGGVYFRDQFYEIYNNSADILYLDGIYFANLTPGTATTKLPIWPEADGNNYAYGERVWKF 180
JCSG3294847 122 KGGVYFRDQFYEIYNNSADILYLDGIYFANLTPGTATTKLPIWPEADGNNYAYGERVWKF 181

QUERY       181 PGNGTEYPLAPGESCIISQFAANHQLDIYNPQSPIDGSSSEFEFNMNNPNFPDQAAYDMQ 240
JCSG3294847 182 PGNGTEYPLAPGESCIISQFAANHQLDIYNPQSPIDGSSSEFEFNMNNPNFPDQAAYDMQ 241

QUERY       241 HVFYQGKAEMGSIPQYLTSVFGGAYVIFRVPEGEAWDPVNDENMKTTDLSKPNSNVYYAK 300
JCSG3294847 242 HVFYQGKAEMGSIPQYLTSVFGGAYVIFRVPEGEAWDPVNDENMKTTDLSKPNSNVYYAK 301

QUERY       301 IPIKYVLDAVEAVNNESKMNAKRVPGVLDAGITWVGATYCGLGIARKLSTDEEGNPIIRE 360
JCSG3294847 302 IPIKYVLDAVEAVNNESKMNAKRVPGVLDAGITWVGATYCGLGIARKLSTDEEGNPIIRE 361

QUERY       361 ETGTYIYQDTNNSTDDFERGVVPVMRRNGAKMPSWNHTL 399
JCSG3294847 362 ETGTYIYQDTNNSTDDFERGVVPVMRRNGAKMPSWNHTL 400

Note
Homologous search is done using BLAST from NCBI BLAST against database pdbnr with expect (E-value cut-off) at 0.001. The structure of a PDB sequence may be fully or partly solved. The non-redundant database pdbnr consists of unique PDB sequences from the representative PDB chains. Each representative chain has the best structural coverage in the set of the same sequences. You could click a sequence ID to see all of PDB chains associated with the sequence ID plus sequence alignments and structural coverages.



Contact Webmaster JCSG Menu