LOADING...
   NP_809759.1;SP16701A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_809759.1    PDB Fold Similairty





PDB sequences with significant alignments
Sequence information                                           Score	E-value
JCSG3262530|pdb|2M4L_A|protein BT_0846                            209	4e-55
PDB sequence alignments
QUERY       22  EDWTELNSNNIIGYWSTGIEGTHKLLSFDEDGTGSFGIYSNATPISFQMFDYKIEEGRIY 81
JCSG3262530 2   EDWTELNSNNIIGYWSTGIEGTHKLLSFDEDGTGSFGIYSNATPISFQMFDYKIEEGRIY 61

QUERY       82  IYDVYPDEKTPYYLDCKISGTTLKVETGSEAGTYKKQK 119
JCSG3262530 62  IYDVYPDEKTPYYLDCKISGTTLKVETGSEAGTYKKQK 99

Note
Homologous search is done using BLAST from NCBI BLAST against database pdbnr with expect (E-value cut-off) at 0.001. The structure of a PDB sequence may be fully or partly solved. The non-redundant database pdbnr consists of unique PDB sequences from the representative PDB chains. Each representative chain has the best structural coverage in the set of the same sequences. You could click a sequence ID to see all of PDB chains associated with the sequence ID plus sequence alignments and structural coverages.



Contact Webmaster JCSG Menu