LOADING...
   NP_809341.1;GE2184A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_809341.1    PDB Fold Similairty





PDB sequences with significant alignments
Sequence information                                           Score	E-value
JCSG3195974|pdb|4R1L_C|Phenylacetate-coenzyme A ligase            871	0.0
JCSG3196035|pdb|2Y4O_A|PHENYLACETATE-COENZYME A LIGASE            357	9e-99
JCSG3196033|pdb|2Y4N_A|PHENYLACETATE-COENZYME A LIGASE            347	7e-96
JCSG2989090|pdb|3LAX_A|Phenylacetate-coenzyme A ligase            149	4e-36
JCSG3191500|pdb|3PBK_A|Fatty Acyl-Adenylate Ligase                44	3e-04
JCSG3262573|pdb|4EAT_A|Benzoate-coenzyme A ligase                 42	6e-04
PDB sequence alignments
QUERY       1   MSTQYWEEEIEIMSREKLQELQLQRLKKTINIAA-N-SPYYKEVFSKNGITGDSIQSLDD 58
JCSG3195974 2   MSTQYWEEEIEIMSREKLQELQLQRLKKTINIAA-N-SPYYKEVFSKNGITGDSIQSLDD 59
JCSG3196035 15  -------EpIEtaSRDELQaLQLERLKwSLRhAydN-vPHYRRTFDaaGVhpDDLKSLaD 66
JCSG3196033 13  -------EpIEtaSRDELtaLQLERLKwSLRhAy-DhSPvYRRkFDEaGVhpDDLKTLaD 64
JCSG2989090     ------------------------------------------------------------
JCSG3191500     ------------------------------------------------------------
JCSG3262573     ------------------------------------------------------------

QUERY       59  IRKIPFTTKSDMRANYPFGLVAGDMKRDGVRIHSSSGTTGNPTVIVHSQHDLDSWANLVA 118
JCSG3195974 60  IRKIPFTTKSDMRANYPFGLVAGDMKRDGVRIHSSSGTTGNPTVIVHSQHDLDSWANLVA 119
JCSG3196035 67  LaKFPFSTKNDLRdNYPFGLfAvp-REQvVRVHASSGTTGKPTVVgYTaRDIDTWANVTA 125
JCSG3196033 65  LsRFPFTTKGDLRdSYPFGMfAvpQdRiS-RIHASSGTTGKPTVVgYTaaDIDTWANLVA 123
JCSG2989090     ------------------------------------------------------------
JCSG3191500     ------------------------------------------------------------
JCSG3262573 181 ----------------------------------SSGSTGRPkgVVHTHaNpywtSELyG 206

QUERY       119 RCLYMVGIRKTDVFQNSSGYGMFTGGLG------FQYGAERLGCLTVPAAAGNSKRQIKF 172
JCSG3195974 120 RCLYMVGIRKTDVFQNSSGYGMFTGGLG------FQYGAERLGCLTVPAAAGNSKRQIKF 173
JCSG3196035 126 RsIraAGgRpgDTLHNAfGYGLFTGGLG------IHYGAERLGCMVVPmSGGQTEKQVQL 179
JCSG3196033 124 RsIraAGaRRgDkvHvSyGYGLFTGGLG------aHYGAERaGltVIPfGGGQTEKQVQL 177
JCSG2989090     ------------------------------------------------------------
JCSG3191500     ------------------------------------------------------------
JCSG3262573 207 R--ntLhLREdDVcfSAAkl-FFAyGLGnaltfpMtvGAttLlmgerPTpdAvfKRwLgg 263

QUERY       173 ISDFKTTALHAIPS-YAIRLAEVFQEEGIDPRETTLKTLVIGA-EPHTDEQRRKIERMLN 230
JCSG3195974 174 ISDFKTTALHAIPS-YAIRLAEVFQEEGIDPRETTLKTLVIGA-EPHTDEQRRKIERMLN 231
JCSG3196035 180 IrDFEpkiIlVtPS-YmLNLiDeMvRQGMDPaESSLKigIFGA-EPwTQalRNEVEtrVG 237
JCSG3196033 178 IQDFRpdiImVtPS-YmLsIADeIERQGLDPvQSSLRigIFGA-EPwTNDMRvaIEQrMG 235
JCSG2989090     ------------------------------------------------------------
JCSG3191500     ------------------------------------------------------------
JCSG3262573 264 VGgvKpTVFYGaPTgYAgmLAa----pNLpsRDqValrLAsSAgEalpaEigQRFQRhFG 319

QUERY       231 VKAYNSFGMTEMNGPGVA-FECQE-QNGMHFWE-DCYLVEIIDPETGEPVPEGEIGELVL 287
JCSG3195974 232 VKAYNSFGMTEMNGPGVA-FECQE-QNGMHFWE-DCYLVEIIDPETGEPVPEGEIGELVL 288
JCSG3196035 238 IdAlDiYGLSEVmGPGVA-cECvEtKDGpvIWE-DhFypEIIDPvTGEvLPDGSqGELVF 295
JCSG3196033 236 IdAvDiYGLSEVmGPGVA-sECvEtKDGptIWE-DhFypEIIDPETGEvLPDGELGELVF 293
JCSG2989090     ------------------------------------------------------------
JCSG3191500     ------------------------------------------------------------
JCSG3262573 320 LdivDGIGsTEMlhifLSnLpdRv-RyGttgWpvpgYqIELrg-DgGgPVaDGEpGDLyI 377

QUERY       288 TTLDREMMPL-IRYRTRDLTRILPGKCPCGRTHLRID----RIKGRSDDMFIIKGVNIFP 342
JCSG3195974 289 TTLDREMMPL-IRYRTRDLTRILPGKCPCGRTHLRID----RIKGRSDDMFIIKGVNIFP 343
JCSG3196035 296 TSLtKEaMPV-IRYRTRDLTaLLP---PtARAmrRLa----KItGRSDDMLIVRGVNVFP 347
JCSG3196033 294 TSLtKEaLPI-IRYRTRDLTRLLPG---tARTmrRME----KItGRSDDMMIVRGVNVFP 345
JCSG2989090 3   ----------------------------------------------ADDMIILKGVNIFP 16
JCSG3191500 455 ------------------------------------------VtGRikDLIIIRGrNIWP 472
JCSG3262573 378 hgpSsatMywgnRaKSRDtfQ--gGwtksGdkYVRnDdgsytyaGRTDDMLkVSGIyVsP 435

QUERY       343 MQVEKILVQFPELGSNYLITLETVNNQDEMIVEVELSDLSTDNYIELEK--IRRDIIR-- 398
JCSG3195974 344 MQVEKILVQFPELGSNYLITLETVNNQDEMIVEVELSDLSTDNYIELEK--IRRDIIR-- 399
JCSG3196035 348 sQIEEIVVaLPlLSGQFqITLSrdGHMDRLdLaVELrSeAAaSvtDgERaaLaRELqH-- 405
JCSG3196033 346 tQIEEqLLKqraLApHYqIVLtkeGplDvLtLNVEpcpeTApDtaaIQv--aKQaLay-- 401
JCSG2989090 17  IQIEtILLQFkELGSDYLITLETAESNDEMtVEVELSQLfTDDYgRLQa--LtREItR-- 72
JCSG3191500 473 QDIEyIaeQePEIhSGdaIAFvTAQEKiiLqIQcRISD---------EE--rRgQLIHal 521
JCSG3262573 436 FEIEatLVQhP------------------------------------------------- 446

QUERY       399 --QLKDEILVTPKVKLVKKGSLP-Q-SEGKAVRVKDLRDNK 435
JCSG3195974 400 --QLKDEILVTPKVKLVKKGSLP-Q-SEGKAVRVKDLRDNK 436
JCSG3196035 406 --RIKtmVgVSsgVtVLaaGGIPat-AtGKArRViDrR--- 440
JCSG3196033 402 --DIKSlIgVTavINVLpvNGIe-R-SvGKArRVvDkR--- 435
JCSG2989090 73  --QLKDEILVTPRVKLVpKGALP-K-SEGKAVRVKDLR--- 106
JCSG3191500 522 aaRIQSEFgVTaaIdLLpphSIP-RtSSGKpARAE------ 555
JCSG3262573 445 ----------------------------------------- 446

Note
Homologous search is done using BLAST from NCBI BLAST against database pdbnr with expect (E-value cut-off) at 0.001. The structure of a PDB sequence may be fully or partly solved. The non-redundant database pdbnr consists of unique PDB sequences from the representative PDB chains. Each representative chain has the best structural coverage in the set of the same sequences. You could click a sequence ID to see all of PDB chains associated with the sequence ID plus sequence alignments and structural coverages.



Contact Webmaster JCSG Menu