LOADING...
   NP_463836.1;MJ14477B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_463836.1    PDB Fold Similairty





PDB sequences with significant alignments
Sequence information                                           Score	E-value
JCSG3188011|pdb|3PJ0_A|Lmo0305 protein                            714	0.0
JCSG3164382|pdb|3LWS_A|Aromatic amino acid beta-eliminating...    429	e-120
JCSG977389|pdb|2FM1_D|L-allo-threonine aldolase                   96	3e-20
JCSG217034|pdb|1JG8_A|L-Allo-Threonine Aldolase                   94	1e-19
JCSG108991|pdb|3WLX_B|Low specificity L-threonine aldolase        94	2e-19
JCSG3297385|pdb|3WGB_C|L-allo-threonine aldolase                  91	1e-18
JCSG3297386|pdb|3WGC_B|L-allo-threonine aldolase                  91	2e-18
JCSG3287456|pdb|4LNJ_A|Low-specificity L-threonine aldolase       91	2e-18
JCSG453474|pdb|1SVV_B|Threonine Aldolase                          44	1e-04
JCSG479510|pdb|1V72_A|Aldolase                                    42	5e-04
PDB sequence alignments
QUERY       1   MTNTLKTSYQKTPYKLGGNGPRNVGVLTEALQNI--DDNLESDIYGNGAVIEDFETKIAK 58
JCSG3188011 2   MTNTLKTSYQKTPYKLGGNGPRNVGVLTEALQNI--DDNLESDIYGNGAVIEDFETKIAK 59
JCSG3164382 3   --NrLRTSFQQTtgQISGHGkRNVGVLktAFaaV--aDEMaSDqYGTGAIIEpFEqKFAd 58
JCSG977389  40  ------------------------------------------DVYGEdpTINELErlaAE 57
JCSG217034  32  ------------------------------------------DVYGEdpTINELErlaAE 49
JCSG108991  28  ------------------------------------------DVYGDdpTVNaLQdyaAE 45
JCSG3297385 33  ------------------------------------------DVYGEdpgVNaLEAygAd 50
JCSG3297386 33  ------------------------------------------DVYGEdpgVNaLEAygAd 50
JCSG3287456 28  ------------------------------------------DVYGDdpTVNaLQdyaAE 45
JCSG453474  53  --------------------------------------------------------KaAR 56
JCSG479510  7   ------------PpaLGfSSdNiAGAspEVaQaLvkhSSgQAgpYGTdeLtaQvKrKFCE 54

QUERY       59  ILGK-----QSAVFF-PSG-----TMAQQIALRIWADRKENRRVAYHPLSHLEIHEQDGL 107
JCSG3188011 60  ILGK-----QSAVFF-PSG-----TMAQQIALRIWADRKENRRVAYHPLSHLEIHEQDGL 108
JCSG3164382 59  VLGm-----DDAVFF-PSG-----TMAQQVALRIWSDEtDNRtVAYHPLcHLEIHEQDGL 107
JCSG977389  58  tFGK-----EAALFv-PSG-----TMGNQVS--ImAhtQRGdEVilEadSHIfwYEvgAM 104
JCSG217034  50  tFGK-----EAALFv-PSG-----TMGNQVS--ImAhtQRGdEVilEadSHIfwYEvgAM 96
JCSG108991  46  LsGK-----EAAIFL-PTG-----TQANlVALlshCERgEEyiVGq--aAHnyLfEagGa 92
JCSG3297385 51  LLGK-----EAALFv-PSG-----TMSNlLAVmshCQRgEGavLG--saAHIyrYEaQGs 97
JCSG3297386 51  LLGK-----EAALFv-PSG-----TMSNlLAVmshCQRgEGavLG--saAHIyrYEaQGs 97
JCSG3287456 46  LsGK-----EAAIFL-PTG-----TQANlVALlshCERgEEyiVGq--aAHnyLfEagGa 92
JCSG453474  57  LIGEllerpDAdVhF-iSGgtqtnlIAcSLALRpW------EaViatqLGHIStHEt-Ga 108
JCSG479510  55  IFeR-----DveVFLvPTG-----TaANaLCLsamTppwgN--IycHPaSHINndEcgA- 101

QUERY       108 KELQQIT--PLLL-GTANQLLTID------DIKSLRE----------P-------VSSVL 141
JCSG3188011 109 KELQQIT--PLLL-GTANQLLTID------DIKSLRE----------P-------VSSVL 142
JCSG3164382 108 KELHpIe--tILV-GAADRLMTLD------EIKALpD------------------IAcLL 140
JCSG977389  105 avLSgVm--PhpV-pgkNgaMdpD------DVRKaiR----------PrnihfprTSlIa 145
JCSG217034  97  avLSgVm--PhpV-pgkNgaMdpD------DVRKaiR----------PrnihfprTSlIa 137
JCSG108991  93  avLgSIq--PqpIdAAADgtLpLD------kVamkiK----------Pddihf--ArTkL 132
JCSG3297385 98  avLgSVAlqPVpM--qADgsLALa------DVRAaia----------Pddvhf--TpTrL 137
JCSG3297386 98  avLgSVAlqPVpM--qADgsLALa------DVRAaia----------Pddvyf--TpTrL 137
JCSG3287456 93  avLgSIq--PqpIdAAADgtLpLD------kVamkiK----------Pddihf--ArTkL 132
JCSG453474  109 iEatghk--vVta-pcpDgkLrVa------DIESalH----------e-------nrSeh 142
JCSG479510  102 ---------PeFF-SNGaKLMTVDgpaaklDIvrLRErtrekvgdvht-------TQpAc 144

QUERY       142 IELPQ-------REIGGQLPAFEELEKISEYCHEQGISLHLDGARLWEI--TPFYQKSAE 192
JCSG3188011 143 IELPQ-------REIGGQLPAFEELEKISEYCHEQGISLHLDGARLWEI--TPFYQKSAE 193
JCSG3164382 141 LELPQ-------REIGGvaPAFSELEtISRYCRERGIrLHLDGARLFEM--lPYYEKTAa 191
JCSG977389  146 IEntH-------NRsGGRVvpLENIKEIctiAkEHGINVHIDGARIFNa--SiasgvpVK 196
JCSG217034  138 IEntH-------NRsGGRVvpLENIKEIctiAkEHGINVHIDGARIFNa--SiasgvpVK 188
JCSG108991  133 LSLeN-------tHnGkvLPr-EyLKEawEFtRERNLALHVDGARIFNa--VvaYgcElK 182
JCSG3297385 138 VcLeN-------tHnGkvLP-LpyLREMrElvdEHGLQLHLDGARLFNa--VvasghTVR 187
JCSG3297386 138 VcLeN-------tHnGkvLP-LpyLREMrElvdEHGLQLHLDGARLFNa--VvasghTVR 187
JCSG3287456 133 LSLeN-------tHnGkvLPr-EyLKEawEFtRKRNLALHVDGARIFNa--VvaYgcElK 182
JCSG453474  143 xvIPKlvyisnttEVGtQytk-QELEdISasCkEHGLyLfLDGARLaSalsSPvnDlTla 201
JCSG479510  145 VSItQ-------atevGSIyTLDEIEaIGDvCkSSSLGLHMDGSR--------------- 182

QUERY       193 EICALFDSVYVSFYKGIGGIAGAILAGNDDFVQEAKIWKRRYG-----GDLISLYPYILS 247
JCSG3188011 194 EICALFDSVYVSFYKGIGGIAGAILAGNDDFVQEAKIWKRRYG-----GDLISLYPYILS 248
JCSG3164382 192 EIAGLFDSIYISFYKGLGGIAGAILAGpaaFcQtARIWKRRYG-----GDLISLYPYIVS 246
JCSG977389  197 EyAGyaDSVmfcLsKGLcApVGSVVVGDrDFIERARkaRKmlG-----GgMrQagvlaaA 251
JCSG217034  189 EyAGyaDSVmfcLsxGLcApVGSVVVGDrDFIERARkaRKmlG-----GgMrQagvlaaA 243
JCSG108991  183 EItqycDSftIcLsKGLGtpVGSLLVGNrDYIKRAirWRKmtG-----GgMrQsgilaaA 237
JCSG3297385 188 ELvApFDSVsIcLsKGLGApVGSLLVGShaFIaRARrlRKmvG-----GgMrQagilaqA 242
JCSG3297386 188 ELvApFDSVsIcLsKGLGApVGSLLVGShaFIaRARrlRKmvG-----GgMrQagilaqA 242
JCSG3287456 183 EItqycDSftIcLsKGLGtpVGSLLVGNrDYIKRAirWRKmtG-----GgMrQsgilaaA 237
JCSG453474  202 DIArLtDXfYIGatKAgGxFGeALIilNDaLkpNARhliKQrGalxakGwLLGIqfeVLX 261
JCSG479510  181 ------------------------------------------------------------ 182

QUERY       248 ADYYFEKRIGKMAEYFEAAKGLAERFNSCSGVKTVPEVPVSNMFHVYFENSADEIGAILT 307
JCSG3188011 249 ADYYFEKRIGKMAEYFEAAKGLAERFNSCSGVKTVPEVPVSNMFHVYFENSADEIGAILT 308
JCSG3164382 247 ADYYYElRkdRMGQYYEqAKqLAEQFNAlpGVhTTPEVPVSNMFHLHFDGQAaDISpkLe 306
JCSG977389  252 GiiaLtKmVdRLkEdhEnARfLAlKLKEi-GySVnPEdvkTNMviLrtDN---------- 300
JCSG217034  244 GiiaLtKmVdRLkEdhEnARfLAlKLKEi-GySVnPEdvkTNMviLrtDN---------- 292
JCSG108991  238 GiYaLKNNVARLqEdhDnAawMAEQ----------------------------------- 262
JCSG3297385 243 GlFaLQQHVvRLADdhRrARqLAEgLaAlpGIRldlaqvqTNM--VFLQlTSgE-SApLl 299
JCSG3297386 243 GlFaLQQHVvRLADdhRrARqLAEgLaAlpGIRldlaqvqTNM--VFLQlTSgErApLLA 300
JCSG3287456 238 GmYaLKNNVARLqEdhDnTawMAEQ----------------------------------- 262
JCSG453474  262 kDnlF------------------------------------------------------- 266
JCSG479510  181 ------------------------------------------------------------ 182

QUERY       308 KIQDETGVGISGYLQEKSADVCAFEVSVGDAFAEIPAKNLELVFRCLEKEL 358
JCSG3188011 309 KIQDETGVGISGYLQEKSADVCAFEVSVGDAFAEIPAKNLELVFRCLEKEL 359
JCSG3164382 307 QVQEETGLGFvGYLvDKDG-yCStEISVGDAYGELdqQTrDagFarLRQ-- 354
JCSG977389  299 --------------------------------------------------- 300
JCSG217034  291 --------------------------------------------------- 292
JCSG108991  261 --------------------------------------------------- 262
JCSG3297385 300 aFMkarGIlFSGY-------------------------------------- 312
JCSG3297386 301 -FMkarGIlFSGY-------------------------------------- 312
JCSG3287456 261 --------------------------------------------------- 262
JCSG453474  265 --------------------------------------------------- 266
JCSG479510  181 --------------------------------------------------- 182

Note
Homologous search is done using BLAST from NCBI BLAST against database pdbnr with expect (E-value cut-off) at 0.001. The structure of a PDB sequence may be fully or partly solved. The non-redundant database pdbnr consists of unique PDB sequences from the representative PDB chains. Each representative chain has the best structural coverage in the set of the same sequences. You could click a sequence ID to see all of PDB chains associated with the sequence ID plus sequence alignments and structural coverages.



Contact Webmaster JCSG Menu