LOADING...
   NP_253659.1;SP19119A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_253659.1    PDB Fold Similairty





PDB sequences with significant alignments
Sequence information                                           Score	E-value
JCSG3246704|pdb|4E72_A|uncharacterized protein                    469	e-133
JCSG3210073|pdb|3S5T_A|DUF3298 family protein                     57	1e-08
JCSG1671168|pdb|3CYG_A|Uncharacterized protein                    46	3e-05
PDB sequence alignments
QUERY       24  KPGLDDPLPTERLASEHLKPGCQGEQCPLVNIDTLKFPDEPQLDPIVERALLEMTRENNE 83
JCSG3246704 2   KPGLDDPLPTERLASEHLKPGCQGEQCPLVNIDTLKFPDEPQLDPIVERALLEMTRENNE 61
JCSG3210073     ------------------------------------------------------------
JCSG1671168     ------------------------------------------------------------

QUERY       84  TPLPASLAAYERQFLDSAEPGWSSY---LQAKVREQHDGLVIIELSSYLFTGGAHGMPGR 140
JCSG3246704 62  TPLPASLAAYERQFLDSAEPGWSSY---LQAKVREQHDGLVIIELSSYLFTGGAHGMPGR 118
JCSG3210073 114 ---------------------WySYykgIEShVQlyYkNLLVyRINyneYTGGAHGIymt 152
JCSG1671168 60  --------AqEdHdkDvqHtpYEAY---VSVdVRyEgkdFLsFvVyyYqFTGGAHGItff 108

QUERY       141 GFINYDRRQHKVLSLQDMLVPGQEEAF----WKQAELAHKAWLLANKLDQDADFQKTWPF 196
JCSG3246704 119 GFINYDRRQHKVLSLQDMLVPGQEEAF----WKQAELAHKAWLLANKLDQDADFQKTWPF 174
JCSG3210073 153 tFLNmDliNlRpLKLDDIFTgdyKEALtdllWNQlmadkK--VtTHEalEDmgYgSTgdI 210
JCSG1671168 109 etyNiDlKNsKVLKLyDIIk------------EEAEdTiKSnILkQieQNNTDFfpdaPM 156

QUERY       197 Q------RTPHVALTFGAVTLKYDAYSIAPYSYAHPELKIPYPRLNGIVKPNLFPGRG 248
JCSG3246704 175 Q------RTPHVALTFGAVTLKYDAYSIAPYSYAHPELKIPYPRLNGIVKPNLFPGRG 226
JCSG3210073 211 a------pTeNfyLdkdGITFyYNVYDITPYAmGpvEIKIPYemMEhMLgsN------ 256
JCSG1671168 157 NilkddifSrEfTISkdGLiImYphYDLAPYAsGmPEFvIPWnvIEkFLK-------- 206

Note
Homologous search is done using BLAST from NCBI BLAST against database pdbnr with expect (E-value cut-off) at 0.001. The structure of a PDB sequence may be fully or partly solved. The non-redundant database pdbnr consists of unique PDB sequences from the representative PDB chains. Each representative chain has the best structural coverage in the set of the same sequences. You could click a sequence ID to see all of PDB chains associated with the sequence ID plus sequence alignments and structural coverages.



Contact Webmaster JCSG Menu