LOADING...
   NP_251743.1;SP16046A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_251743.1    PDB Fold Similairty





PDB sequences with significant alignments
Sequence information                                           Score	E-value
JCSG3249142|pdb|4F0J_A|Probable hydrolytic enzyme                 643	0.0
JCSG3244622|pdb|3V1K_A|2-hydroxy-6-oxo-6-phenylhexa-2,4-die...    78	9e-15
JCSG910434|pdb|2OG1_A|2-hydroxy-6-oxo-6-phenylhexa-2,4-die...     78	9e-15
JCSG3244623|pdb|3V1L_A|2-hydroxy-6-oxo-6-phenylhexa-2,4-die...    77	2e-14
JCSG1662136|pdb|2RI6_A|2-hydroxy-6-oxo-6-phenylhexa-2,4-die...    77	2e-14
JCSG1575836|pdb|2PUH_A|2-hydroxy-6-oxo-6-phenylhexa-2,4-die...    77	2e-14
JCSG1575837|pdb|2PU7_A|2-hydroxy-6-oxo-6-phenylhexa-2,4-die...    77	2e-14
JCSG1662145|pdb|2VF2_A|2-HYDROXY-6-OXO-6-PHENYLHEXA-2,4-DIE...    76	3e-14
JCSG3086199|pdb|2WUD_A|2-HYDROXY-6-OXO-6-PHENYLHEXA-2,4-DIE...    75	6e-14
JCSG2886134|pdb|3FOB_A|Bromoperoxidase                            72	4e-13
JCSG3192857|pdb|4X6X_A|Bifunctional epoxide hydrolase 2           70	2e-12
JCSG3299850|pdb|4C4Z_A|BIFUNCTIONAL EPOXIDE HYDROLASE 2           70	2e-12
JCSG3295206|pdb|3WK4_A|Bifunctional epoxide hydrolase 2           70	2e-12
JCSG442781|pdb|4HAI_A|Bifunctional epoxide hydrolase 2            70	2e-12
JCSG3200020|pdb|3PDC_A|Epoxide hydrolase 2                        70	2e-12
JCSG3211344|pdb|2XT0_A|HALOALKANE DEHALOGENASE                    70	3e-12
JCSG3280307|pdb|4JNC_A|Bifunctional epoxide hydrolase 2           69	3e-12
JCSG1479285|pdb|2D0D_A|2-hydroxy-6-oxo-7-methylocta-2,4-die...    69	3e-12
JCSG3302696|pdb|4NS4_A|Alpha/beta hydrolase fold protein          67	2e-11
JCSG3304014|pdb|4MJ3_A|Haloalkane dehalogenase                    67	2e-11
...more
PDB sequence alignments
QUERY       22  SQAPVYGERLEGFD-YAYPVHYLDFTS-QGQPLSMAY-LDVAP-------KK-------A 64
JCSG3249142 2   SQAPVYGERLEGFD-YAYPVHYLDFTS-QGQPLSMAY-LDVAP-------KK-------A 44
JCSG3244622     ------------------------------------------------------------
JCSG910434      ------------------------------------------------------------
JCSG3244623     ------------------------------------------------------------
JCSG1662136     ------------------------------------------------------------
JCSG1575836     ------------------------------------------------------------
JCSG1575837     ------------------------------------------------------------
JCSG1662145 43  -------------------------------PLKLhY-hEAGv----------------G 54
JCSG3086199 23  -------------------------------PLKLhY-hEAGv----------------G 34
JCSG2886134 11  -------------------------TE-NqaPIEIyY-eD-----------h-------G 25
JCSG3192857 7   --------------------HHhhtSc-NpSdMShGY-VtVkP-------RvrlhfvelG 37
JCSG3299850 8   --------------------------------MShGY-VtVkP-------RvrlhfvelG 27
JCSG3295206 237 --------------------------------MShGY-VtVkP-------RvrlhfvelG 256
JCSG442781  237 --------------------------------MShGY-VtVkP-------RvrlhfvelG 256
JCSG3200020 33  --------------------------------MShGY-VtVkP-------RvrlhfvelG 52
JCSG3211344 16  -------------D-FpYapHYLEglp-gfEgLrMhY-VDeGP-------Rd-------A 45
JCSG3280307 2   ---------------------------------ShGY-VtVkP-------RvrlhfvelG 20
JCSG1479285     ------------------------------------------------------------
JCSG3302696 43  -----------------------DLTT-QSftLSsGd-kiVya-------EN-------G 63
JCSG3304014 16  -------------D-FpFapRYVEvdSgDGgtLrMhY-LDeG---------R-------S 44

QUERY       65  N--GR-TILLMHGK--N---FCA---GT---W---E---R--T--IDVLAD--AGYRVIA 98
JCSG3249142 45  N--GR-TILLMHGK--N---FCA---GT---W---E---R--T--IDVLAD--AGYRVIA 78
JCSG3244622 32  N--GE-TVIMLHGg--G---pgA---Gg---W---SnyyR--N--VgpFVD--AGYRVIl 68
JCSG910434  32  N--GE-TVIMLHGg--G---pgA---Gg---W---SnyyR--N--VgpFVD--AGYRVIl 68
JCSG3244623 32  N--GE-TVIMLHGg--G---pgA---Gg---W---SnyyR--N--VgpFVD--AGYRVIl 68
JCSG1662136 29  N--GE-TVIMLHGg--G---pgA---Gg---W---SnyyR--N--VgpFVD--AGYRVIl 65
JCSG1575836 32  N--GE-TVIMLHGg--G---pgA---Gg---W---SnyyR--N--VgpFVD--AGYRVIl 68
JCSG1575837 32  N--GE-TVIMLHGg--G---pgA---Gg---W---SnyyR--N--VgpFVD--AGYRVIl 68
JCSG1662145 55  N--dQ-TVVLLHGg--G---pgA---AS---WtnfS---R--N--IaVLA---rhFHVLA 90
JCSG3086199 35  N--dQ-TVVLLHGg--G---pgA---AS---WtnfS---R--N--IaVLA---rhFHVLA 70
JCSG2886134 26  T--GK-pVVLIHGw--p---LsG---rS---W---E---y--q--VpALVE--AGYRVIT 59
JCSG3192857 38  S--Gp-AVcLcHGf--p---esw---yS---W---R---y--q--IpALAQ--AGYRVLA 71
JCSG3299850 28  S--Gp-AVcLcHGf--p---esw---yS---W---R---y--q--IpALAQ--AGYRVLA 61
JCSG3295206 257 S--Gp-AVcLcHGf--p---esw---yS---W---R---y--q--IpALAQ--AGYRVLA 290
JCSG442781  257 S--Gp-AVcLcHGf--p---esw---yS---W---R---y--q--IpALAQ--AGYRVLA 290
JCSG3200020 53  S--Gp-AVcLcHGf--p---esw---yS---W---R---y--q--IpALAQ--AGYRVLA 86
JCSG3211344 46  E---H-TFLcLHGE--p---swS---fl---Y---R---K--m--LpVFTa--AGgRVVA 78
JCSG3280307 21  S--Gp-AVcLcHGf--p---esw---yS---W---R---y--q--IpALAQ--AGYRVLA 54
JCSG1479285 25  ---GQ-pVILIHGS--GpgvsAy---AN---W---R---l--T--IpALSk--f-YRVIA 59
JCSG3302696 64  NvaGE-pLLLVHGf--G---gnk---dN---F---t---R--i--arqLeN----YNLIi 97
JCSG3304014 45  D--GE-VVLLLHGE--p---swS---yl---Y---R---w--m--IpVLVE--AGlRAVA 78

QUERY       99  VDQ--VGF------CKSS-K----P----A----H--Y---Q-Y--SFQ-QLAA----NT 124
JCSG3249142 79  VDQ--VGF------CKSS-K----P----A----H--Y---Q-Y--SFQ-QLAA----NT 104
JCSG3244622 69  kDS--pGF------nKSD-a----v----V----m--d---E-q--rgl-vnAr----aV 94
JCSG910434  69  kDS--pGF------nKSD-a----v----V----m--d---E-q--rgl-vnAr----aV 94
JCSG3244623 69  kDS--pGF------nKSD-a----v----V----m--d---E-q--rgl-vnAr----aV 94
JCSG1662136 66  kDS--pGF------nKSD-a----v----V----m--d---E-q--rgl-vnAr----aV 91
JCSG1575836 69  kDS--pGF------nKSD-a----v----V----m--d---E-q--rgl-vnAr----aV 94
JCSG1575837 69  kDS--pGF------nKSD-a----v----V----m--d---E-q--rgl-vnAr----aV 94
JCSG1662145 91  VDQ--pGY------ghSD-K----r----A----E--H---g-q--fnR-yaAm----al 116
JCSG3086199 71  VDQ--pGY------ghSD-K----r----A----E--H---g-q--fnR-yaAm----al 96
JCSG2886134 60  yDR--rGF------gKSS-Q----P----w----E------g-Y--EYD-tFTS----Dl 84
JCSG3192857 72  MDM--kGY------gESS-a----P----p----E--i---EeY--cME-vLCk----Em 98
JCSG3299850 62  MDM--kGY------gESS-a----P----p----E--i---EeY--cME-vLCk----Em 88
JCSG3295206 291 MDM--kGY------gESS-a----P----p----E--i---EeY--cME-vLCk----Em 317
JCSG442781  291 MDM--kGY------gESS-a----P----p----E--i---EeY--cME-vLCk----Em 317
JCSG3200020 87  MDM--kGY------gESS-a----P----p----E--i---EeY--cME-vLCk----Em 113
JCSG3211344 79  pDl--fGF------gRSD-K----Ptdd-A----v--Y---t-F--GFH-R--r----Sl 105
JCSG3280307 55  MDM--kGY------gESS-a----P----p----E--i---EeY--cME-vLCk----Em 81
JCSG1479285 60  pDM--VGF------gfTD-R----P----e----N--Y---N-Y--SkD-SwVd----Hi 85
JCSG3302696 98  pDl--LGF------gdSS-K----P----m----a--a---D-Y--hsE-aqAT----Rl 123
JCSG3304014 79  IDl--VGF------gRSD-K----Pt---S----R--d---D-Y--TYQ-ahVd----wm 105

QUERY       125 H--AL--LERL--GV-ARA-SVIGHSMGGMLATRY-ALLY-PR-Q----VERL----V-- 163
JCSG3249142 105 H--AL--LERL--GV-ARA-SVIGHSMGGMLATRY-ALLY-PR-Q----VERL----V-- 143
JCSG3244622 95  k--GL--MDaL--dI-dRA-hLVGNSMGGatAlNF-ALeY-Pd-R----IgKL----I-- 133
JCSG910434  95  k--GL--MDaL--dI-dRA-hLVGNSMGGatAlNF-ALeY-Pd-R----IgKL----I-- 133
JCSG3244623 95  k--GL--MDaL--dI-dRA-hLVGNAMGGatAlNF-ALeY-Pd-R----IgKL----I-- 133
JCSG1662136 92  k--GL--MDaL--dI-dRA-hLVGNAMGGatAlNF-ALeY-Pd-R----IgKL----I-- 130
JCSG1575836 95  k--GL--MDaL--dI-dRA-hLVGNAMGGatAlNF-ALeY-Pd-R----IgKL----I-- 133
JCSG1575837 95  k--GL--MDaL--dI-dRA-hLVGNAMGGatAlNF-ALeY-Pd-R----IgKL----I-- 133
JCSG1662145 117 k--GL--FDQL--GL-GRV-pLVGNSLGGgtAVRF-ALdY-Pa-R----AgRL----V-- 155
JCSG3086199 97  k--GL--FDQL--GL-GRV-pLVGNALGGgtAVRF-ALdY-Pa-R----AgRL----V-- 135
JCSG2886134 85  H--qL--LEQL--eL-qNV-TLVGfSMGGgeVARY-istYgtd-R----IEKV----V-- 124
JCSG3192857 99  v--TF--LDKL--GL-SQA-vfIGHDwGGMLVwym-ALFY-PE-R----VRaV----A-- 137
JCSG3299850 89  v--TF--LDKL--GL-SQA-vfIGHDwGGMLVwym-ALFY-PE-R----VRaV----A-- 127
JCSG3295206 318 v--TF--LDKL--GL-SQA-vfIGHDwGGMLVwym-ALFY-PE-R----VRaV----A-- 356
JCSG442781  318 v--TF--LDKL--GL-SQA-vfIGHDwGGMLVwym-ALFY-PE-R----VRaV----A-- 356
JCSG3200020 114 v--TF--LDKL--GL-SQA-vfIGHDwGGMLVwym-ALFY-PE-R----VRaV----A-- 152
JCSG3211344 106 l--AF--LDaL--qL-eRV-TLVcQDwGGILGltl-pVdr-PQ-l----VDRL----I-- 144
JCSG3280307 82  v--TF--LDKL--GL-SQA-vfIGHDwGGMLVwym-ALFY-PE-R----VRaV----A-- 120
JCSG1479285 86  i--GI--MDaL--eI-eKA-hIVGNSFGGgLAiat-ALrY-sE-R----VDRM----V-- 124
JCSG3302696 124 H--eL--LQak--GL-AsSihVgGNSMGGaISVaY-AakY-PK-E----VKsL----w-- 163
JCSG3304014 106 w--Aa--IEEI--GL-AdV-TLVcQDwGGLIGlRl-VgeH-Pd-R----faRV----V-- 144

QUERY       164 L------V---------N-----P-I----G----L-----E-DW--------------- 173
JCSG3249142 144 L------V---------N-----P-I----G----L-----E-DW--------------- 153
JCSG3244622 134 L------M---------G-----P-g----G----L-----g-ps--------------- 143
JCSG910434  134 L------M---------G-----P-g----G----L-----g-ps--------------- 143
JCSG3244623 134 L------M---------G-----P-g----G----L-----g-ps--------------- 143
JCSG1662136 131 L------M---------G-----P-g----G----L-----g-ps--------------- 140
JCSG1575836 134 L------M---------G-----P-g----G----L-----g-ps--------------- 143
JCSG1575837 134 L------M---------G-----P-g----G----L-----g-ps--------------- 143
JCSG1662145 156 L------M---------G-----P-g----G----L-----S-in--------------- 165
JCSG3086199 136 L------M---------G-----P-g----G----L-----S-in--------------- 145
JCSG2886134 125 F------A---------G-----a-V----p----p-----y-lY--------------- 134
JCSG3192857 138 s------L---------N------------------------------------------ 140
JCSG3299850 128 s------L---------N------------------------------------------ 130
JCSG3295206 357 s------L---------N------------------------------------------ 359
JCSG442781  357 s------L---------N------------------------------------------ 359
JCSG3200020 153 s------L---------N------------------------------------------ 155
JCSG3211344 145 V------M---------Ntal--a-V----G----L-----S-pg--------------- 157
JCSG3280307 121 s------L---------N------------------------------------------ 123
JCSG1479285 125 L------M---------G-----a-V----Gtr--F-----D-vt--------------- 136
JCSG3302696 164 L------I---------D-----s-a----G----F--------W--------------- 171
JCSG3304014 145 a------A---------N------------------------------------------ 147

QUERY       174 --KA--------------L----GVPW---------R-----SVDDWYR--RDL-Q---- 192
JCSG3249142 154 --KA--------------L----GVPW---------R-----SVDDWYR--RDL-Q---- 172
JCSG3244622 144 --mf--------------a----pMPm---------E-----GIkllFK--lya-E---- 162
JCSG910434  144 --mf--------------a----pMPm---------E-----GIkllFK--lya-E---- 162
JCSG3244623 144 --mf--------------a----pMPm---------E-----GIkllFK--lya-E---- 162
JCSG1662136 141 --mf--------------a----pMPm---------E-----GIkllFK--lya-E---- 159
JCSG1575836 144 --mf--------------a----pMPm---------E-----GIkllFK--lya-E---- 162
JCSG1575837 144 --mf--------------a----pMPm---------E-----GIkllFK--lya-E---- 162
JCSG1662145 166 --lf--------------a----pdPt---------E-----GVkrlsK--fSV-a---- 184
JCSG3086199 146 --lf--------------a----pdPt---------E-----GVkrlsK--fSV-a---- 164
JCSG2886134 135 --KS--------------e----dhPe---------g-----ALDD-------------- 146
JCSG3192857 139 ------------------------------------------------------------ 140
JCSG3299850 129 ------------------------------------------------------------ 130
JCSG3295206 358 ------------------------------------------------------------ 359
JCSG442781  358 ------------------------------------------------------------ 359
JCSG3200020 154 ------------------------------------------------------------ 155
JCSG3211344 158 --KG--------------F-----esW---------RdfvanSpDldvg--KlM-Q---- 180
JCSG3280307 122 ------------------------------------------------------------ 123
JCSG1479285 137 --EG--------------L----NAvWgytpsienmR-----NLlDiFa--yDr-S---- 164
JCSG3302696 172 --SA-------------------GVP----------K-----SLESatl--ENn-p---- 188
JCSG3304014 146 ------------------------------------------------------------ 147

QUERY       193 --T-SA--EGIRQY-QQAT----YY--------AGE--W----R-----------P---- 213
JCSG3249142 173 --T-SA--EGIRQY-QQAT----YY--------AGE--W----R-----------P---- 193
JCSG3244622 163 --p-Sy--EtLKQm-lQVf----lY----------------------------------- 177
JCSG910434  163 --p-Sy--EtLKQm-lQVf----lY----------------------------------- 177
JCSG3244623 163 --p-Sy--EtLKQm-lQVf----lY----------------------------------- 177
JCSG1662136 160 --p-Sy--EtLKQm-lQVf----lY----------------------------------- 174
JCSG1575836 163 --p-Sy--EtLKQm-lQVf----lY----------------------------------- 177
JCSG1575837 163 --p-Sy--EtLKQm-lQVf----lY----------------------------------- 177
JCSG1662145 185 --p-Tr--ENLEaF-lRVm----vY--------dkN--li---t-----------P---- 206
JCSG3086199 165 --p-Tr--ENLEaF-lRVm----vY--------dkN--li---t-----------P---- 186
JCSG2886134 145 ------------------------------------------------------------ 146
JCSG3192857 139 ------------------------------------------------------------ 140
JCSG3299850 129 ------------------------------------------------------------ 130
JCSG3295206 358 ------------------------------------------------------------ 359
JCSG442781  358 ------------------------------------------------------------ 359
JCSG3200020 154 ------------------------------------------------------------ 155
JCSG3211344 181 --r-Ai--pGItDa-EvAA----Yd--------Apf--p----g-----------P---- 201
JCSG3280307 122 ------------------------------------------------------------ 123
JCSG1479285 165 --l-vT--DeLaRl-R--------Y--------eAS--i----Q-----------P---- 181
JCSG3302696 189 --l-lV--DkkEDF-yamy----dF--------VmS--k----p-----------P---- 209
JCSG3304014 146 ------------------------------------------------------------ 147

QUERY       214 -EF--D--RWV------Q--MQAGM-YR--GKGRESVAWNSAL-T--------------- 241
JCSG3249142 194 -EF--D--RWV------Q--MQAGM-YR--GKGRESVAWNSAL-T--------------- 221
JCSG3244622 176 ------------------------------------------------------------ 177
JCSG910434  176 ------------------------------------------------------------ 177
JCSG3244623 176 ------------------------------------------------------------ 177
JCSG1662136 173 ------------------------------------------------------------ 174
JCSG1575836 176 ------------------------------------------------------------ 177
JCSG1575837 176 ------------------------------------------------------------ 177
JCSG1662145 207 -ELvdQ--RFAlastpeS--LtAtr-am--GKSfaGAdFEAGM-m--------------- 242
JCSG3086199 187 -ELvdQ--RFAlastpeS--LtAtr-am--GKSfaGAdFEAGM-m--------------- 222
JCSG2886134 145 ------------------------------------------------------------ 146
JCSG3192857 139 ------------------------------------------------------------ 140
JCSG3299850 129 ------------------------------------------------------------ 130
JCSG3295206 358 ------------------------------------------------------------ 359
JCSG442781  358 ------------------------------------------------------------ 359
JCSG3200020 154 ------------------------------------------------------------ 155
JCSG3211344 202 -EF--k--agV------R------------------------------------------ 208
JCSG3280307 122 ------------------------------------------------------------ 123
JCSG1479285 182 -gF--Q--Esf------S--sMfpe-pR--qRwiDALAsSDe------------------ 207
JCSG3302696 210 -yI--p--KsV------K--avfAQ-eRiaNKAlESkilaQiV-e--------------- 239
JCSG3304014 146 ------------------------------------------------------------ 147

QUERY       242 YDM-----I--F-------TQ-PV---VYELDRLQ---M----------PTLLLIGEKDN 270
JCSG3249142 222 YDM-----I--F-------TQ-PV---VYELDRLQ---M----------PTLLLIGEKDN 250
JCSG3244622 176 ------------------------------------------------------------ 177
JCSG910434  176 ------------------------------------------------------------ 177
JCSG3244623 176 ------------------------------------------------------------ 177
JCSG1662136 173 ------------------------------------------------------------ 174
JCSG1575836 176 ------------------------------------------------------------ 177
JCSG1575837 176 ------------------------------------------------------------ 177
JCSG1662145 243 Wre-----V--Y--------------------RLR---Q----------PVLLIwGREDR 262
JCSG3086199 223 Wre-----V--Y--------------------RLR---Q----------PVLLIwGREDR 242
JCSG2886134 145 ------------------------------------------------------------ 146
JCSG3192857 139 ------------------------------------------------------------ 140
JCSG3299850 129 ------------------------------------------------------------ 130
JCSG3295206 358 ------------------------------------------------------------ 359
JCSG442781  358 ------------------------------------------------------------ 359
JCSG3200020 154 ------------------------------------------------------------ 155
JCSG3211344 207 ------------------------------------------------------------ 208
JCSG3280307 122 ------------------------------------------------------------ 123
JCSG1479285 208 -----------------------------DIktLp---n----------eTLIIhGRED- 224
JCSG3302696 240 dNV-----e--q-------ra-kV---ItEyN------I----------PTLVVwGEEDK 265
JCSG3304014 146 ------------------------------------------------------------ 147

QUERY       271 TAIGKDAAPAELKARLGNYAQLGKDAARRIPQATLVEFPDLGHTPQIQAPE---RFHQAL 327
JCSG3249142 251 TAIGKDAAPAELKARLGNYAQLGKDAARRIPQATLVEFPDLGHTPQIQAPE---RFHQAL 307
JCSG3244622 176 ------------------------------------------------------------ 177
JCSG910434  176 ------------------------------------------------------------ 177
JCSG3244623 176 ------------------------------------------------------------ 177
JCSG1662136 173 ------------------------------------------------------------ 174
JCSG1575836 176 ------------------------------------------------------------ 177
JCSG1575837 176 ------------------------------------------------------------ 177
JCSG1662145 263 Vn-plDGAlVaLKT---------------IPRAqLhvFgQcGHwvQVEkfD---EFNKlt 303
JCSG3086199 243 Vn-plDGAlVaLKT---------------IPRAqLhvFgQcGHwvQVEkfD---EFNKlt 283
JCSG2886134 145 ------------------------------------------------------------ 146
JCSG3192857 139 ------------------------------------------------------------ 140
JCSG3299850 129 ------------------------------------------------------------ 130
JCSG3295206 358 ------------------------------------------------------------ 359
JCSG442781  358 ------------------------------------------------------------ 359
JCSG3200020 154 ------------------------------------------------------------ 155
JCSG3211344 207 ------------------------------------------------------------ 208
JCSG3280307 122 ------------------------------------------------------------ 123
JCSG1479285 225 -----QVVPlSsSlRLGEl----------IdRAqLhvFgrcGHwtQIEqtD---RFNRlV 266
JCSG3302696 266 --ViKpeTvTlIK--------------EiIPQSqVItMPkIGHVPMIEAvKdtaNdYKAF 309
JCSG3304014 146 ------------------------------------------------------------ 147

QUERY       328 LEGLQTQP 335
JCSG3249142 308 LEGLQTQP 315
JCSG3244622 176 -------- 177
JCSG910434  176 -------- 177
JCSG3244623 176 -------- 177
JCSG1662136 173 -------- 174
JCSG1575836 176 -------- 177
JCSG1575837 176 -------- 177
JCSG1662145 304 IEfL---- 307
JCSG3086199 284 IEfL---- 287
JCSG2886134 145 -------- 146
JCSG3192857 139 -------- 140
JCSG3299850 129 -------- 130
JCSG3295206 358 -------- 359
JCSG442781  358 -------- 359
JCSG3200020 154 -------- 155
JCSG3211344 207 -------- 208
JCSG3280307 122 -------- 123
JCSG1479285 267 VE------ 268
JCSG3302696 310 rEGLK--- 314
JCSG3304014 146 -------- 147

Note
Homologous search is done using BLAST from NCBI BLAST against database pdbnr with expect (E-value cut-off) at 0.001. The structure of a PDB sequence may be fully or partly solved. The non-redundant database pdbnr consists of unique PDB sequences from the representative PDB chains. Each representative chain has the best structural coverage in the set of the same sequences. You could click a sequence ID to see all of PDB chains associated with the sequence ID plus sequence alignments and structural coverages.



Contact Webmaster JCSG Menu