LOADING...
   NM_002092;NM_002092
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NM_002092    PDB Fold Similairty





PDB sequences with significant alignments
Sequence information                                           Score	E-value
JCSG3229738|pdb|2LMI_A|G-rich sequence factor 1                   216	2e-56
JCSG3298234|pdb|4QU7_A|G-rich sequence factor 1                   169	3e-42
JCSG3257019|pdb|2LXU_A|Heterogeneous nuclear ribonucleoprot...    108	1e-23
JCSG1488299|pdb|2KG1_A|Heterogeneous nuclear ribonucleoprot...    107	2e-23
JCSG469954|pdb|1WEZ_A|Heterogeneous nuclear ribonucleoprot...     106	4e-23
JCSG1482028|pdb|2DB1_A|heterogeneous nuclear ribonucleoprot...    101	1e-21
JCSG1488297|pdb|2HGL_A|Heterogeneous nuclear ribonucleoprot...    100	2e-21
JCSG469970|pdb|1WG5_A|Heterogeneous nuclear ribonucleoprot...     100	2e-21
JCSG1488298|pdb|2HGM_A|Heterogeneous nuclear ribonucleoprot...    94	2e-19
JCSG1491949|pdb|2DHA_A|FLJ20171 protein                           68	1e-11
JCSG1491640|pdb|2DGW_A|Probable RNA-binding protein 19            58	1e-08
JCSG975252|pdb|1WEL_A|RNA-binding protein 12                      58	2e-08
JCSG1497584|pdb|2DNN_A|RNA-binding protein 12                     55	1e-07
JCSG976172|pdb|2CPY_A|RNA-binding protein 12                      50	3e-06
JCSG976093|pdb|2CQP_A|RNA-binding protein 12                      44	3e-04
PDB sequence alignments
QUERY       140 SKLEEEVDDVFLIRAQGLPWSCTMEDVLNFFSD-CR-IRNGENGIHFLLNRDGKRRGDAL 197
JCSG3229738 2   SKLEEEVDDVFLIRAQGLPWSCTMEDVLNFFSD-CR-IRNGENGIHFLLNRDGKRRGDAL 59
JCSG3229738     ------------------------------------------------------------
JCSG3229738     ------------------------------------------------------------
JCSG3298234     ------------------------------------------------------------
JCSG3298234     ------------------------------------------------------------
JCSG3298234 4   ------------VHmRGLPFQANaQDIINFFAp-lKpVR-----ItMeySsSGKatGEAd 45
JCSG3257019 8   ----------FVVKVRGLPWSCSaDEVqRFFSD-CK-IQNGaQGIRFIyTREGRpsGEAF 55
JCSG3257019     ------------------------------------------------------------
JCSG3257019     ------------------------------------------------------------
JCSG1488299     ------------------------------------------------------------
JCSG1488299     ------------------------------------------------------------
JCSG1488299 49  ------------VHmRGLPYKATeNDIyNFFSp-lNpVR-----VHIeIGpDGRvtGEAd 90
JCSG469954      ------------------------------------------------------------
JCSG469954      ------------------------------------------------------------
JCSG469954  18  ------------VHmRGLPYrATeNDIyNFFSp-lN-pmR----VHIeIGpDGRvtGEAd 59
JCSG1482028 10  --LgpEggEgYVVKlRGLPWSCSIEDVqNFLSD-Ct-IHDGvaGVHFIyTREGRQsGEAF 65
JCSG1482028     ------------------------------------------------------------
JCSG1482028     ------------------------------------------------------------
JCSG1488297 37  --LgpEggEgFVVKlRGLPWSCSVEDVqNFLSD-Ct-IHDGaaGVHFIyTREGRQsGEAF 92
JCSG1488297     ------------------------------------------------------------
JCSG1488297     ------------------------------------------------------------
JCSG469970      ------------------------------------------------------------
JCSG469970      ------------------------------------------------------------
JCSG469970  18  ------------VRlRGLPFGCSkEEIVQFFSg-lE-Iv--pNGMtLpVDfQGRstGEAF 61
JCSG1488298     ------------------------------------------------------------
JCSG1488298 34  SNsaDSANDgF-VRlRGLPFGCTkEEIVQFFSg-lE-Iv--pNGItLpVDpEGKitGEAF 88
JCSG1488298     ------------------------------------------------------------
JCSG1491949 25  -----------IVRmRGLPFTATaEEVVaFFGQhCp-ItGGKEGIlFVtypDGRptGDAF 72
JCSG1491949     ------------------------------------------------------------
JCSG1491949     ------------------------------------------------------------
JCSG1491640     ------------------------------------------------------------
JCSG1491640     ------------------------------------------------------------
JCSG1491640 13  ------------VKlRGaPFNvTeKNVMEFLAp-lK-----pvAIRIVrNahGNKtGyiF 54
JCSG975252      ------------------------------------------------------------
JCSG975252  26  ----------FcVylKGLPFEAenKhVIDFFKk-ld-Iv--EDSIYIayGpNGKatGEGF 71
JCSG975252      ------------------------------------------------------------
JCSG1497584 15  -------DDLY-VsVHGMPFSAmeNDVrDFFhg-lR-V----DAVHLLkDHvGRNNGNGL 60
JCSG1497584     ------------------------------------------------------------
JCSG976172  23  -----------------IPFSiTkmDVLQFLEg-ip-V--dENAVHvLVDNNGQglGQAL 61
JCSG976093      ------------------------------------------------------------

QUERY       198 IEMESEQDVQKALEKHRMYMGQRYVEVYEINN----EDVDALMKS--LQVKSSPVVNDGV 251
JCSG3229738 60  IEMESEQDVQKALEKHRMYMGQRYVEVYEINN----EDVDALMKS--LQVKSSP------ 107
JCSG3229738 13  -----------------------------------------------------------L 13
JCSG3229738     ------------------------------------------------------------
JCSG3298234     ------------------------------------------------------------
JCSG3298234     ------------------------------------------------------------
JCSG3298234 46  VHFETHEDAvaAMlKdRsHVhHRYIELF-------------------------------- 73
JCSG3257019 56  VELESEDEVKlALKKdRetMGHRYVEVFKsNN----vEMDwVLKh--tgpNSpdTANDG- 108
JCSG3257019 9   -----------------------------------------------------------V 9
JCSG3257019     ------------------------------------------------------------
JCSG1488299     ------------------------------------------------------------
JCSG1488299     ------------------------------------------------------------
JCSG1488299 91  VEFaTHEEAvaAMSKdRanMqHRYIELF-------------------------------- 118
JCSG469954      ------------------------------------------------------------
JCSG469954      ------------------------------------------------------------
JCSG469954  60  VEFaTHEDAvaAMaKdKanMqHRYVELF-------------------------------- 87
JCSG1482028 66  VELESEDDVKlALKKdResMGHRYIEVFKsHR----tEMDwVLK---------------- 105
JCSG1482028 19  -----------------------------------------------------------V 19
JCSG1482028     ------------------------------------------------------------
JCSG1488297 93  VELgSEDDVKmALKKdResMGHRYIEVFKsHR----tEMDwVLK---------------- 132
JCSG1488297 46  -----------------------------------------------------------V 46
JCSG1488297     ------------------------------------------------------------
JCSG469970  9   ---------------------------------------------------SpdTANDGf 17
JCSG469970      ------------------------------------------------------------
JCSG469970  62  VQFaSQEiAEKALKKHKerIGHRYIEIFKsSR----aEV--------------------- 96
JCSG1488298 36  ---------------------------------------------------SAdsANDGf 44
JCSG1488298 89  VQFaSQElAEKALgKHKerIGHRYIEVFKsSQ----EEV--------------------- 123
JCSG1488298     ------------------------------------------------------------
JCSG1491949 73  VlFacEEyAQNALRKHKdlLGKRYIELFRsTa----aEVQqVLNr--FSsaSGP------ 120
JCSG1491949 22  --------------------------------------------------------NQvI 25
JCSG1491949     ------------------------------------------------------------
JCSG1491640     ------------------------------------------------------------
JCSG1491640     ------------------------------------------------------------
JCSG1491640 55  VDFSNEEEVKQALKcNReYMGgRYIEVF-------------------------------- 82
JCSG975252      ------------------------------------------------------------
JCSG975252  72  VEFRNEaDyKaALcRHKQYMGNRFIQVHpITKkgmlEkIDmIrKr--LQ----------- 118
JCSG975252      ------------------------------------------------------------
JCSG1497584 61  VKFlSpQDTfEALKRNRMlMiQRYVEV--------------------------------- 87
JCSG1497584 15  --------------------------------------------------------DDly 18
JCSG976172  62  VQFKNEDDARKSeRlHRkkLNgReAfVHvVTl----EDMreIeKNppaQgKSGP------ 111
JCSG976093      ------------------------------------------------------------

QUERY       252 VRLRGLPYSCNEKDIVDFFAGLNIVD-----ITFVMDYRGRRK-TGEAYVQFEEPEMANQ 305
JCSG3229738 106 ------------------------------------------------------------ 107
JCSG3229738 14  IRaQGLPWSCTmEDVLNFFSdcRIrNgeng-IhFLLNrdGKRR--GDAlIEMESeQdVQK 70
JCSG3229738     ------------------------------------------------------------
JCSG3298234     ------------------------------------------------------------
JCSG3298234 4   VHMRGLPFQANaQDIINFFApLKpVr-----IT--MEYsSsgKaTGEAdVHFEthEdAva 56
JCSG3298234 72  ------------------------------------------------------------ 73
JCSG3257019 107 ------------------------------------------------------------ 108
JCSG3257019 10  VKVRGLPWSCSadEVqrFFSdcKIqNgaqg-IrFIytrEGR-p-SGEAFVELESeDeVKl 66
JCSG3257019     ------------------------------------------------------------
JCSG1488299     ------------------------------------------------------------
JCSG1488299 49  VHMRGLPYKATENDIyNFFSpLNpVr-----VhIeIgpdG-Rv-TGEAdVEFathEeAva 101
JCSG1488299 117 ------------------------------------------------------------ 118
JCSG469954      ------------------------------------------------------------
JCSG469954  18  VHMRGLPYrATENDIyNFFSpLNpMr-----VhIeIgpdG-Rv-TGEAdVEFathEdAva 70
JCSG469954  86  ------------------------------------------------------------ 87
JCSG1482028 104 ------------------------------------------------------------ 105
JCSG1482028 20  VKLRGLPWSCSiEDVqNFLSdcTIhDgvag-VhFIytrEGRQ--SGEAFVELESeDdVKl 76
JCSG1482028     ------------------------------------------------------------
JCSG1488297 131 ------------------------------------------------------------ 132
JCSG1488297 47  VKLRGLPWSCSvEDVqNFLSdcTIhDgaag-VhFIytrEGRQ--SGEAFVELgSeDdVKM 103
JCSG1488297     ------------------------------------------------------------
JCSG469970  18  VRLRGLPFGCSKEEIVQFFSGLEIVpng---MTLpVDFQGR-S-TGEAFVQFaSqEIAEK 72
JCSG469970      ------------------------------------------------------------
JCSG469970  95  ------------------------------------------------------------ 96
JCSG1488298 45  VRLRGLPFGCTKEEIVQFFSGLEIVpng---ITLpVDpEGKi--TGEAFVQFaSqELAEK 99
JCSG1488298 122 ------------------------------------------------------------ 123
JCSG1488298     ------------------------------------------------------------
JCSG1491949 119 ------------------------------------------------------------ 120
JCSG1491949 26  VRMRGLPFTATaEEVVaFFGqhcpItggkegIlFVt-YpdgRp-TGDAFVlFaceEyAQN 83
JCSG1491949     ------------------------------------------------------------
JCSG1491640 13  VKLRGaPFNvTEKNVMEFLApLKpVa-----IrIVrNaHGN-K-TGyiFVDFSNeEeVKQ 65
JCSG1491640     ------------------------------------------------------------
JCSG1491640 81  ------------------------------------------------------------ 82
JCSG975252  28  VyLKGLPFEAENKhVIDFFkkLDIVE-----dSIyIaYgpNgKaTGEGFVEFRNeadyKa 82
JCSG975252  117 ------------------------------------------------------------ 118
JCSG975252      ------------------------------------------------------------
JCSG1497584 86  ------------------------------------------------------------ 87
JCSG1497584 19  VsVHGMPFSAmENDVrDFFhGLRVda-----VhLLkDHvG-RN-NGNGlVKFlSPQdTfE 71
JCSG976172  110 ------------------------------------------------------------ 111
JCSG976093      ------------------------------------------------------------

QUERY       306 ALLKHREEIGNRYIEIFPSRRNEVRTHVGSYKGKKIASFPTAKYITEPEMVFEEHEVNED 365
JCSG3229738 106 ------------------------------------------------------------ 107
JCSG3229738 71  ALeKHRmyMGQRYVEVYeiNNEDV------------------------------------ 94
JCSG3229738     ------------------------------------------------------------
JCSG3298234     ------------------------------------------------------------
JCSG3298234 57  AMLKdRSHVhHRYIELF------------------------------------------- 73
JCSG3298234 72  ------------------------------------------------------------ 73
JCSG3257019 107 ------------------------------------------------------------ 108
JCSG3257019 67  ALkKdREtMGHRYVEVFkSNNvEM------------------------------------ 90
JCSG3257019     ------------------------------------------------------------
JCSG1488299     ------------------------------------------------------------
JCSG1488299 102 AMsKdRaNMqHRYIELF------------------------------------------- 118
JCSG1488299 117 ------------------------------------------------------------ 118
JCSG469954      ------------------------------------------------------------
JCSG469954  71  AMaKdKaNMqHRYVELF------------------------------------------- 87
JCSG469954  86  ------------------------------------------------------------ 87
JCSG1482028 104 ------------------------------------------------------------ 105
JCSG1482028 77  ALkKdRESMGHRYIEVFkSHRTEM-dwVlKHSGpNsASgPSS------------------ 117
JCSG1482028     ------------------------------------------------------------
JCSG1488297 131 ------------------------------------------------------------ 132
JCSG1488297 104 ALkKdRESMGHRYIEVFkSHRTEM------------------------------------ 127
JCSG1488297     ------------------------------------------------------------
JCSG469970  73  ALkKHKERIGHRYIEIFkSsRaEVRT---------------------------------- 98
JCSG469970      ------------------------------------------------------------
JCSG469970  95  ------------------------------------------------------------ 96
JCSG1488298 100 ALgKHKERIGHRYIEVFkSsQEEVRSY--------------------------------- 126
JCSG1488298 122 ------------------------------------------------------------ 123
JCSG1488298     ------------------------------------------------------------
JCSG1491949 119 ------------------------------------------------------------ 120
JCSG1491949 84  ALrKHKDlLGKRYIELFrStaaEVQ----------------------------------- 108
JCSG1491949     ------------------------------------------------------------
JCSG1491640 66  ALkcNREyMGGRYIEVF------------------------------------------- 82
JCSG1491640     ------------------------------------------------------------
JCSG1491640 81  ------------------------------------------------------------ 82
JCSG975252  83  ALcRHKQyMGNRFIQVhPitKKgMlekIdmiR-KRLqSgPSS------------------ 123
JCSG975252  117 ------------------------------------------------------------ 118
JCSG975252      ------------------------------------------------------------
JCSG1497584 86  ------------------------------------------------------------ 87
JCSG1497584 72  ALkRNRmlMiQRYVEVsPAtERQ------------------------------------- 94
JCSG976172  110 ------------------------------------------------------------ 111
JCSG976093      ------------------------------------------------------------

QUERY       366 IQPMTAFESEKEIELPKEVPEKLPEAADFGTTSSLHFVHMRGLPFQANAQDIINFFAPLK 425
JCSG3229738 106 ------------------------------------------------------------ 107
JCSG3229738 93  ------------------------------------------------------------ 94
JCSG3229738 3   ---------------------KLeEeVD-----DVfLIRaQGLPWSCTmEDVLNFFSdcR 36
JCSG3298234 1   ----------------------------------MHFVHMRGLPFQANAQDIINFFAPLK 26
JCSG3298234 72  ------------------------------------------------------------ 73
JCSG3298234 72  ------------------------------------------------------------ 73
JCSG3257019 107 ------------------------------------------------------------ 108
JCSG3257019 89  ------------------------------------------------------------ 90
JCSG3257019 10  -------------------------------------VkVRGLPWSCSADEVqRFFSdcK 32
JCSG1488299 47  -----------------------------------HcVHMRGLPYKATeNDIyNFFSPLN 71
JCSG1488299 117 ------------------------------------------------------------ 118
JCSG1488299 117 ------------------------------------------------------------ 118
JCSG469954  16  -----------------------------------HcVHMRGLPYRATeNDIyNFFSPLN 40
JCSG469954  86  ------------------------------------------------------------ 87
JCSG469954  86  ------------------------------------------------------------ 87
JCSG1482028 104 ------------------------------------------------------------ 105
JCSG1482028 116 ------------------------------------------------------------ 117
JCSG1482028 18  -----------------------------------YvVkLRGLPWSCSiEDVqNFLSdct 42
JCSG1488297 131 ------------------------------------------------------------ 132
JCSG1488297 126 ------------------------------------------------------------ 127
JCSG1488297 47  -------------------------------------VkLRGLPWSCSVEDVqNFLSdct 69
JCSG469970  97  ------------------------------------------------------------ 98
JCSG469970  12  -------------------------------TANdgFVRLRGLPFgCSkEEIVQFFSgLE 40
JCSG469970  95  ------------------------------------------------------------ 96
JCSG1488298 125 ------------------------------------------------------------ 126
JCSG1488298 122 ------------------------------------------------------------ 123
JCSG1488298 44  ------------------------------------FVRLRGLPFgCTkEEIVQFFSgLE 67
JCSG1491949 119 ------------------------------------------------------------ 120
JCSG1491949 107 ------------------------------------------------------------ 108
JCSG1491949 13  ------------------------EVAQFlSkENqvIVRMRGLPFtATAEEVVaFFGqhc 48
JCSG1491640 81  ------------------------------------------------------------ 82
JCSG1491640 7   -----------------------------GTTc--HtVkLRGaPFNVTeKNVMEFLAPLK 35
JCSG1491640 81  ------------------------------------------------------------ 82
JCSG975252  122 ------------------------------------------------------------ 123
JCSG975252  117 ------------------------------------------------------------ 118
JCSG975252  28  -------------------------------------VYLKGLPFEAEnKhVIDFFkkLd 50
JCSG1497584 86  ------------------------------------------------------------ 87
JCSG1497584 93  ------------------------------------------------------------ 94
JCSG976172  110 ------------------------------------------------------------ 111
JCSG976093  18  -------------------------------------IkVQNMPFtVSiDEILDFFygyQ 40

QUERY       426 ----PVR-----ITMEYSSSGKATGEADVHFETHEDAVAAM--LKDRSHVHHRYIELFLN 474
JCSG3229738 106 ------------------------------------------------------------ 107
JCSG3229738 93  ------------------------------------------------------------ 94
JCSG3229738 37  -----IRngengIhFllNrDGKrrGDAlIEMESEQDVqkAL--eKhRmYMgQRYVEVY-- 87
JCSG3298234 27  ----PVR-----ITMEYSSSGKATGEADVHFETHEDAVAAM--LKDRSHVHHRYIELFLN 75
JCSG3298234 72  ------------------------------------------------------------ 73
JCSG3298234 72  ------------------------------------------------------------ 73
JCSG3257019 107 ------------------------------------------------------------ 108
JCSG3257019 89  ------------------------------------------------------------ 90
JCSG3257019 33  ----iqNgaqg-IrFiYTrEGRpSGEAfVELESEDEVklAL--kKDREtMgHRYVEVF-- 83
JCSG1488299 72  ----PVR-----VhIEiGpDGRVTGEADVEFaTHEEAVAAM--sKDRANMQHRYIELFLN 120
JCSG1488299 117 ------------------------------------------------------------ 118
JCSG1488299 117 ------------------------------------------------------------ 118
JCSG469954  41  ----PMR-----VhIEiGpDGRVTGEADVEFaTHEDAVAAM--aKDKANMQHRYVELFLN 89
JCSG469954  86  ------------------------------------------------------------ 87
JCSG469954  86  ------------------------------------------------------------ 87
JCSG1482028 104 ------------------------------------------------------------ 105
JCSG1482028 116 ------------------------------------------------------------ 117
JCSG1482028 43  ihdgvAg-----VhFiYTrEGRqSGEAfVELESEDDVklAL--kKDREsMgHRYIEVF-- 93
JCSG1488297 131 ------------------------------------------------------------ 132
JCSG1488297 126 ------------------------------------------------------------ 127
JCSG1488297 70  ihdgaAg-----VhFiYTrEGRqSGEAfVELgSEDDVkmAL--kKDREsMgHRYIEVF-- 120
JCSG469970  97  ------------------------------------------------------------ 98
JCSG469970  41  iv--Png-----MTLpvDfQGRSTGEAfVQFaSQEiAekAL--kKhKERIgHRYIEIFkS 91
JCSG469970  95  ------------------------------------------------------------ 96
JCSG1488298 125 ------------------------------------------------------------ 126
JCSG1488298 122 ------------------------------------------------------------ 123
JCSG1488298 68  iv--Png-----ITLpvDpEGKiTGEAfVQFaSQElAekAL--gKhKERIgHRYIEVFkS 118
JCSG1491949 119 ------------------------------------------------------------ 120
JCSG1491949 107 ------------------------------------------------------------ 108
JCSG1491949 49  ----PItggkegIlFvtypDGRpTGDAfVlFacEEyAqnAL--rKhKDlLgkRYIELF-- 100
JCSG1491640 81  ------------------------------------------------------------ 82
JCSG1491640 36  ----PVa-----IrIvrNAhGNkTGyifVdFSNEEEVkqAL--kcNREYMggRYIEVF-- 82
JCSG1491640 81  ------------------------------------------------------------ 82
JCSG975252  122 ------------------------------------------------------------ 123
JCSG975252  117 ------------------------------------------------------------ 118
JCSG975252  51  ----iVEds---IyIaYGpNGKATGEGfVEFRNEaDykAAL--cRhKQYMgNRFIQV--- 98
JCSG1497584 86  ------------------------------------------------------------ 87
JCSG1497584 93  ------------------------------------------------------------ 94
JCSG976172  110 ------------------------------------------------------------ 111
JCSG976093  41  vi--Pgs-----VcLKYNEKGmpTGEAmVaFESRDEATAAVidLNDRp-IgsRkVKLvLG 92

QUERY       475 SCPKGK 480
JCSG3229738 106 ------ 107
JCSG3229738 93  ------ 94
JCSG3229738 86  ------ 87
JCSG3298234 76  SCPKGK 81
JCSG3298234 72  ------ 73
JCSG3298234 72  ------ 73
JCSG3257019 107 ------ 108
JCSG3257019 89  ------ 90
JCSG3257019 82  ------ 83
JCSG1488299 121 S----- 121
JCSG1488299 117 ------ 118
JCSG1488299 117 ------ 118
JCSG469954  90  S----- 90
JCSG469954  86  ------ 87
JCSG469954  86  ------ 87
JCSG1482028 104 ------ 105
JCSG1482028 116 ------ 117
JCSG1482028 92  ------ 93
JCSG1488297 131 ------ 132
JCSG1488297 126 ------ 127
JCSG1488297 119 ------ 120
JCSG469970  97  ------ 98
JCSG469970  92  S----- 92
JCSG469970  95  ------ 96
JCSG1488298 125 ------ 126
JCSG1488298 122 ------ 123
JCSG1488298 119 S----- 119
JCSG1491949 119 ------ 120
JCSG1491949 107 ------ 108
JCSG1491949 99  ------ 100
JCSG1491640 81  ------ 82
JCSG1491640 81  ------ 82
JCSG1491640 81  ------ 82
JCSG975252  122 ------ 123
JCSG975252  117 ------ 118
JCSG975252  97  ------ 98
JCSG1497584 86  ------ 87
JCSG1497584 93  ------ 94
JCSG976172  110 ------ 111
JCSG976093  93  SgP--- 95

Note
Homologous search is done using BLAST from NCBI BLAST against database pdbnr with expect (E-value cut-off) at 0.001. The structure of a PDB sequence may be fully or partly solved. The non-redundant database pdbnr consists of unique PDB sequences from the representative PDB chains. Each representative chain has the best structural coverage in the set of the same sequences. You could click a sequence ID to see all of PDB chains associated with the sequence ID plus sequence alignments and structural coverages.



Contact Webmaster JCSG Menu