LOADING...
   BC043071;BC043071
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
BC043071    PDB Fold Similairty





PDB sequences with significant alignments
Sequence information                                           Score	E-value
JCSG3210520|pdb|2YH0_A|SPLICING FACTOR U2AF 65 KDA SUBUNIT        390	e-108
JCSG1488581|pdb|2G4B_A|Splicing factor U2AF 65 kDa subunit        328	5e-90
JCSG3261439|pdb|3VAF_A|Splicing factor U2AF 65 kDa subunit        328	5e-90
JCSG3301791|pdb|4TU7_A|Splicing factor U2AF 65 kDa subunit        325	5e-89
JCSG3248630|pdb|2M52_A|Splicing factor U2AF 65 kDa subunit        224	1e-58
JCSG300496|pdb|1O0P_A|Splicing factor U2AF 65 kDa subunit         222	5e-58
JCSG3259693|pdb|4FXW_A|Splicing factor U2AF 65 kDa subunit        214	1e-55
JCSG219300|pdb|1U2F_A|PROTEIN (SPLICING FACTOR U2AF 65 KD ...     184	8e-47
JCSG220260|pdb|2U2F_A|PROTEIN (SPLICING FACTOR U2AF 65 KD ...     171	1e-42
JCSG1488580|pdb|2HZC_A|Splicing factor U2AF 65 kDa subunit        165	5e-41
JCSG3179953|pdb|2KXF_A|Poly(U)-binding-splicing factor PUF60      70	3e-12
JCSG3229989|pdb|3UWT_A|Poly(U)-binding-splicing factor PUF60      70	3e-12
JCSG1673236|pdb|2QFJ_B|FBP-interacting repressor                  70	3e-12
JCSG221025|pdb|1JMT_B|SPLICING FACTOR U2AF 65 KDA SUBUNIT         66	6e-11
JCSG3303684|pdb|4RU2_D|Splicing factor U2AF 65 kDa subunit        66	6e-11
JCSG307614|pdb|1P1T_A|Cleavage stimulation factor, 64 kDa ...     64	2e-10
JCSG302187|pdb|1FNX_H|HU ANTIGEN C                                60	2e-09
JCSG470275|pdb|1U6F_A|RNA-binding protein UBP1                    60	3e-09
JCSG1478924|pdb|3PGW_S|U1-70K                                     55	1e-07
JCSG3297613|pdb|4LMZ_A|CUGBP Elav-like family member 2            43	4e-04
...more
PDB sequence alignments
QUERY       8   ERQLNENKQERDKENRHRKRSHSRSRSRDR-KRR-SRSRD----RRNRDQ-RSASRDRRR 60
JCSG3210520     ------------------------------------------------------------
JCSG1488581     ------------------------------------------------------------
JCSG3261439     ------------------------------------------------------------
JCSG3301791     ------------------------------------------------------------
JCSG3248630     ------------------------------------------------------------
JCSG300496      ------------------------------------------------------------
JCSG3259693     ------------------------------------------------------------
JCSG219300      ------------------------------------------------------------
JCSG220260      ------------------------------------------------------------
JCSG1488580     ------------------------------------------------------------
JCSG3179953     ------------------------------------------------------------
JCSG3179953     ------------------------------------------------------------
JCSG3229989     ------------------------------------------------------------
JCSG3229989     ------------------------------------------------------------
JCSG1673236     ------------------------------------------------------------
JCSG1673236     ------------------------------------------------------------
JCSG221025      ------------------------------------------------------------
JCSG3303684     ------------------------------------------------------------
JCSG307614      ------------------------------------------------------------
JCSG302187      ------------------------------------------------------------
JCSG302187      ------------------------------------------------------------
JCSG470275      ------------------------------------------------------------
JCSG1478924 238 ERErRERSRERDKERERR-----RSRSRDR-RRR-SRSRDkeerRRSRERsKDkDRDRKR 290
JCSG1478924 231 --------RDRDRDRERERRERSRERDKEReRRR-SRSRD----RRRRSR-srdKEERRR 276
JCSG1478924 231 -------------------RDRDRDRERER-RER-SRERD----KERErR-RSrSRDRRR 264
JCSG1478924 260 -RDrRRRSRSRDKEERRRSRERSKDKDRDR-KRRsSRSRE----RaRRER---------- 303
JCSG3297613     ------------------------------------------------------------

QUERY       61  ---RSKPLTRGAKEEHGGLIRSPRHEKKKKVRKYWDVPPPGFEHITPMQYKAMQAAGQIP 117
JCSG3210520     ------------------------------------------------------------
JCSG1488581     ------------------------------------------------------------
JCSG3261439     ------------------------------------------------------------
JCSG3301791     ------------------------------------------------------------
JCSG3248630     ------------------------------------------------------------
JCSG300496      ------------------------------------------------------------
JCSG3259693     ------------------------------------------------------------
JCSG219300      ------------------------------------------------------------
JCSG220260      ------------------------------------------------------------
JCSG1488580     ------------------------------------------------------------
JCSG3179953     ------------------------------------------------------------
JCSG3179953     ------------------------------------------------------------
JCSG3229989     ------------------------------------------------------------
JCSG3229989     ------------------------------------------------------------
JCSG1673236     ------------------------------------------------------------
JCSG1673236     ------------------------------------------------------------
JCSG221025  1   ---------------------------KKKVRKYWDVPPPGFEHITPMQYKAMQA----- 28
JCSG3303684 2   ---------------------------KKKVRKYWDVPPPGFEHITPMQYKAMQA----- 29
JCSG307614      ------------------------------------------------------------
JCSG302187      ------------------------------------------------------------
JCSG302187      ------------------------------------------------------------
JCSG470275      ------------------------------------------------------------
JCSG1478924 291 ---RSSrsrErARRE--------------------------------------------- 302
JCSG1478924 277 sreRSKdkdRdrKRRsSrsrEraRRERERK------------------------------ 306
JCSG1478924 265 ---RSR--SRdkEERRrSreRSkdkDRdRKrR---------------------------- 291
JCSG1478924 302 ------------------------------------------------------------ 303
JCSG3297613     ------------------------------------------------------------

QUERY       118 ATALLPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEEAMMDFF---NAQMR 174
JCSG3210520 4   ------------------------------ARRLYVGNIPFGITEEAMMDFF---NAQMR 30
JCSG1488581 4   ------------------------------ARRLYVGNIPFGITEEAMMDFF---NAQMR 30
JCSG3261439 6   ------------------------------ARRLYVGNIPFGITEEAMMDFF---NAQMR 32
JCSG3301791 6   ------------------------------ARRLYVGNIPFGITEEAMMDFF---NAQMR 32
JCSG3248630     ------------------------------------------------------------
JCSG300496      ------------------------------------------------------------
JCSG3259693     ------------------------------------------------------------
JCSG219300  1   ------------------------------ARRLYVGNIPFGITEEAMMDFF---NAQMR 27
JCSG220260      ------------------------------------------------------------
JCSG1488580 6   ------------------------------ARRLYVGNIPFGITEEAMMDFF---NAQMR 32
JCSG3179953 15  --------------------------------RVYVGSIyYeLgEDTIrQaF-------- 34
JCSG3179953     ------------------------------------------------------------
JCSG3229989 14  --------------------------------RVYVGSIyYeLgEDTIrQaF-------- 33
JCSG3229989     ------------------------------------------------------------
JCSG1673236 30  --------------------------------RVYVGSIyYeLgEDTIrQaF-------- 49
JCSG1673236     ------------------------------------------------------------
JCSG221025  27  ------------------------------------------------------------ 28
JCSG3303684 28  ------------------------------------------------------------ 29
JCSG307614      ------------------------------------------------------------
JCSG302187      ------------------------------------------------------------
JCSG302187      ------------------------------------------------------------
JCSG470275      ------------------------------------------------------------
JCSG1478924 301 ------------------------------------------------------------ 302
JCSG1478924 305 ------------------------------------------------------------ 306
JCSG1478924 290 ------------------------------------------------------------ 291
JCSG1478924 302 ------------------------------------------------------------ 303
JCSG3297613 1   -----------------------GSHMdpDAiKMFVGQIPrSwSEKeLkELFepyGAvyQ 37

QUERY       175 LGGLTQAPGNPVLAVQINQD------K------N-----FAFLEF-R---SVDETTQA-- 211
JCSG3210520 31  LGGLTQAPGNPVLAVQINQD------K------N-----FAFLEF-R---SVDETTQA-- 67
JCSG1488581 31  LGGLTQAPGNPVLAVQINQD------K------N-----FAFLEF-R---SVDETTQA-- 67
JCSG3261439 33  LGGLTQAPGNPVLAVQINQD------K------N-----FAFLEF-R---SVDETTQA-- 69
JCSG3301791 33  LGGLTQAPGNPVLAVQINQD------K------N-----FAFLEF-R---SVDETTQA-- 69
JCSG3248630     ------------------------------------------------------------
JCSG300496      ------------------------------------------------------------
JCSG3259693     ------------------------------------------------------------
JCSG219300  28  LGGLTQAPGNPVLAVQINQD------K------N-----FAFLEF-R---SVDETTQA-- 64
JCSG220260      ------------------------------------------------------------
JCSG1488580 33  LGGLTQAPGNPVLAVQINQD------K------N-----FAFLEF-R---SVDETTQA-- 69
JCSG3179953 35  ------APfGPIkSIDMSwDsvtmkhK------G-----FAFVEY-E---vpEaAqlA-- 71
JCSG3179953     ------------------------------------------------------------
JCSG3229989 34  ------APfGPIkSIDMSwDsvtmkhK------G-----FAFVEY-E---vpEaAqlA-- 70
JCSG3229989     ------------------------------------------------------------
JCSG1673236 50  ------APfGPIkSIDMSwDsvtmkhK------G-----FAFVEY-E---vpEaAqlA-- 86
JCSG1673236     ------------------------------------------------------------
JCSG221025  27  ------------------------------------------------------------ 28
JCSG3303684 28  ------------------------------------------------------------ 29
JCSG307614      ------------------------------------------------------------
JCSG302187      ------------------------------------------------------------
JCSG302187      ------------------------------------------------------------
JCSG470275      ------------------------------------------------------------
JCSG1478924 301 ------------------------------------------------------------ 302
JCSG1478924 305 ------------------------------------------------------------ 306
JCSG1478924 290 ------------------------------------------------------------ 291
JCSG1478924 302 ------------------------------------------------------------ 303
JCSG3297613 38  INvLrDrsqNP------pQS------K------G-----cCFVtF-y---TrkaAlEA-- 68

QUERY       212 -M-A-FDGIIFQGQSLKIRR--PHDY-----QPL-PGMSENPSVYVPGVVSTVVPDSAH- 259
JCSG3210520 68  -M-A-FDGIIFQGQSLKIRR--PHDY-----QPL-PGMSENPSVYVPGVVSTVVPDSAH- 115
JCSG1488581 68  -M-A-FDGIIFQGQSLKIRR--PHDY-----QPL-PG--------------------AH- 95
JCSG3261439 70  -M-A-FDGIIFQGQSLKIRR--PHDY-----QPL-PG--------------------AH- 97
JCSG3301791 70  -M-A-FDGIIFQGQSLKIRR--PHvY-----QPL-PG--------------------AH- 97
JCSG3248630     ------------------------------------------------------------
JCSG300496      ------------------------------------------------------------
JCSG3259693     ------------------------------------------------------------
JCSG219300  65  -M-A-FDGIIFQGQSLKIRR--PHDY-----QPL-PG----------------------- 90
JCSG220260  1   ---------------------------------------------------------AH- 2
JCSG1488580 70  -M-A-FDGIIFQGQSLKIRR--P------------------------------------- 87
JCSG3179953 72  -L-eqMNSVMLgGRNIKVgR--PsNigqa--QPIidqLAEEarAF-------------N- 111
JCSG3179953 0   ------------------------------------------------------------
JCSG3229989 71  -L-eqMNSVMLgGRNIKVgR--PsNigqa--QPIidqLAEEarAF-------------N- 110
JCSG3229989 0   ------------------------------------------------------------
JCSG1673236 87  -L-eqMNSVMLgGRNIKVgR--PsNigqa--QPIidqLAEEarAF-------------N- 126
JCSG1673236 0   ------------------------------------------------------------
JCSG221025  27  ------------------------------------------------------------ 28
JCSG3303684 28  ------------------------------------------------------------ 29
JCSG307614  4   -----------------------------------------------------VdrSlR- 9
JCSG302187  2   -------------------------------------------------------DSkt- 5
JCSG302187  78  -------------------------------------------------VSyArPSSAsi 88
JCSG470275  19  ---------------------------------L-qqLQQQqQqHIPpTqmNpePDvlR- 43
JCSG1478924 301 ------------------------------------------------------------ 302
JCSG1478924 305 ------------------------------------------------------------ 306
JCSG1478924 290 ------------------------------------------------------------ 291
JCSG1478924 302 ------------------------------------------------------------ 303
JCSG3297613 69  -Q----------------Na--lHNi-----KtL-PGM-HHPiqmkPAdsEksnavEdR- 101

QUERY       260 ---KLFIGGLPNYLNDDQVKELLTSFGP-LKAFNLVKDSATGLSKGYAFCEYVDINVTDQ 315
JCSG3210520 116 ---KLFIGGLPNYLNDDQVKELLTSFGP-LKAFNLVKDSATGLSKGYAFCEYVDINVTDQ 171
JCSG1488581 96  ---KLFIGGLPNYLNDDQVKELLTSFGP-LKAFNLVKDSATGLSKGYAFCEYVDINVTDQ 151
JCSG3261439 98  ---KLFIGGLPNYLNDDQVKELLTSFGP-LKAFNLVKDSATGLSKGYAFCEYVDINVTDQ 153
JCSG3301791 98  ---KLFIGGLPNYLNDDQVKELLTSFGP-LKAFNLVKDSATGLSKGYAFCEYVDINVTDQ 153
JCSG3248630     ------------------------------------------------------------
JCSG300496      ------------------------------------------------------------
JCSG3259693     ------------------------------------------------------------
JCSG219300  89  ------------------------------------------------------------ 90
JCSG220260  3   ---KLFIGGLPNYLNDDQVKELLTSFGP-LKAFNLVKDSATGLSKGYAFCEYVDINVTDQ 58
JCSG1488580 86  ------------------------------------------------------------ 87
JCSG3179953 112 ---RIYVASVhQdLSDDDIKSVFeAFGk-IKScTLARDpTTGkhKGYGFiEYekaQsSQD 167
JCSG3179953 15  ---RVYVGSIyyeLGEDtIRQaFApFGP-IKSIDMswDSVTmkhKGFAFvEYevpEAAQl 70
JCSG3229989 111 ---RIYVASVhQdLSDDDIKSVFeAFGk-IKScTLARDpTTGkhKGYGFiEYekaQsSQD 166
JCSG3229989 14  ---RVYVGSIyyeLGEDtIRQaFApFGP-IKSIDMswDSVTmkhKGFAFvEYevpEAAQl 69
JCSG1673236 127 ---RIYVASVhQdLSDDDIKSVFeAFGk-IKSaTLARDpTTGkhKGYGFiEYekaQsSQD 182
JCSG1673236 30  ---RVYVGSIyyeLGEDtIRQaFApFGP-IKSIDMswDSVTmkhKGFAFvEYevpEAAQl 85
JCSG221025  27  ------------------------------------------------------------ 28
JCSG3303684 28  ------------------------------------------------------------ 29
JCSG307614  10  ---SVFVGNIPyeaTEEQLKDIFSEvGP-VvSFRLVyDreTGkpKGYGFCEYqDqETAlS 65
JCSG302187  6   ---NLIVNyLPQnMTQDEfKSLFgSIGd-IEScKLVRDKiTGqSlGYGFvNYsDpNdADK 61
JCSG302187  89  rdaNLYVSGLPKtMSQkEMEQLFSQYGr-IiTsRILlDQATGVSRGvGFiRFdkrieAEE 147
JCSG470275  44  ---NLMVNyIPTtVDEvQLRQLFerYGP-IESvKIVcDreTrqSRGYGFvKFqSgSsAQQ 99
JCSG1478924 301 ------------------------------------------------------------ 302
JCSG1478924 305 ------------------------------------------------------------ 306
JCSG1478924 290 ------------------------------------------------------------ 291
JCSG1478924 302 ------------------------------------------------------------ 303
JCSG3297613 102 ---KLFIGmVsKkcNENDIRvMFSpFGq-IEecRILR-GpdGLSRGcAFvtFstraMAQN 156

QUERY       316 AIA----GLNGM--QLGDKKLLVQRA------SVGAKNATLSTINQTPVTLQVPGLMSSQ 363
JCSG3210520 172 AIA----GLNGM--QLGDKKLLVQRA------SVGAKNA--------------------- 198
JCSG1488581 152 AIA----GLNGM--QLGDKKLLVQRA------S--------------------------- 172
JCSG3261439 154 AIA----GLNGM--QLGDKKLLVQRA------S--------------------------- 174
JCSG3301791 154 AIA----GLNGM--QLGDKKLLVQRA------S--------------------------- 174
JCSG3248630     ------------------------------------------------------------
JCSG300496      ------------------------------------------------------------
JCSG3259693     ------------------------------------------------------------
JCSG219300  89  ------------------------------------------------------------ 90
JCSG220260  59  AIA----GLNGM--QLGDKKLLVQRA------SVGAKNA--------------------- 85
JCSG1488580 86  ------------------------------------------------------------ 87
JCSG3179953 168 AVS----SMNlF--DLGgQyLrVgKA---------------------------------- 187
JCSG3179953 71  ALe----qMNSV--MLGgRNIkVgRp------S--------------------------- 91
JCSG3229989 167 AVS----SMNlF--DLGgQyLrVgKA---------------------------------- 186
JCSG3229989 70  ALe----qMNSV--MLGgRNIkVgRp------S--------------------------- 90
JCSG1673236 183 AVS----SMNlF--DLGgQyLrVgKA---------------------------------- 202
JCSG1673236 86  ALe----qMNSV--MLGgRNIkVgRp------S--------------------------- 106
JCSG221025  27  ------------------------------------------------------------ 28
JCSG3303684 28  ------------------------------------------------------------ 29
JCSG307614  66  AMr----NLNGr--EFSgRaLrVDNA------A--------------------------- 86
JCSG302187  62  AIn----tLNGL--KLqtKtIkVSyA------r--pSSASIrdaN-----LyVsGLpKTM 102
JCSG302187  148 AIk----GLNGQ--K--------------------------------------------- 156
JCSG470275  100 AIA----GLNGF--NIlNKRLkValA------AsG------------------------- 122
JCSG1478924 301 ------------------------------------------------------------ 302
JCSG1478924 305 ------------------------------------------------------------ 306
JCSG1478924 290 ------------------------------------------------------------ 291
JCSG1478924 302 ------------------------------------------------------------ 303
JCSG3297613 157 AIk----AMHqs--Q--------------------------------------------- 165

QUERY       364 VQMGGHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKS---IEIPRPVDGV 420
JCSG3210520 197 ------------------------------------------------------------ 198
JCSG1488581 171 ------------------------------------------------------------ 172
JCSG3261439 173 ------------------------------------------------------------ 174
JCSG3301791 173 ------------------------------------------------------------ 174
JCSG3248630 1   ---GGHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKS---IEIPRPVDGV 54
JCSG300496  1   ----GHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKS---IEIPRPVDGV 53
JCSG3259693 6   -------TEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKS---IEIPRPVDGV 55
JCSG219300  89  ------------------------------------------------------------ 90
JCSG220260  84  ------------------------------------------------------------ 85
JCSG1488580 86  ------------------------------------------------------------ 87
JCSG3179953 186 ------------------------------------------------------------ 187
JCSG3179953 90  ------------------------------------------------------------ 91
JCSG3229989 185 ------------------------------------------------------------ 186
JCSG3229989 89  ------------------------------------------------------------ 90
JCSG1673236 201 ------------------------------------------------------------ 202
JCSG1673236 105 ------------------------------------------------------------ 106
JCSG221025  27  ------------------------------------------------------------ 28
JCSG3303684 28  ------------------------------------------------------------ 29
JCSG307614  85  ------------------------------------------------------------ 86
JCSG302187  103 sQ-----------------------KEmEQLf-------SQYGrIiT---sRI--lLDqA 127
JCSG302187  155 ------------------------------------------------------------ 156
JCSG470275  121 ------------------------------------------------------------ 122
JCSG1478924 301 ------------------------------------------------------------ 302
JCSG1478924 305 ------------------------------------------------------------ 306
JCSG1478924 290 ------------------------------------------------------------ 291
JCSG1478924 302 ------------------------------------------------------------ 303
JCSG3297613 164 ------------------------------------------------------------ 165

QUERY       421 EVPG--CGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW 471
JCSG3210520 197 ----------------------------------------------------- 198
JCSG1488581 171 ----------------------------------------------------- 172
JCSG3261439 173 ----------------------------------------------------- 174
JCSG3301791 173 ----------------------------------------------------- 174
JCSG3248630 55  EVPG--CGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW 105
JCSG300496  54  EVPG--CGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW 104
JCSG3259693 56  EVPG--CGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW 106
JCSG219300  89  ----------------------------------------------------- 90
JCSG220260  84  ----------------------------------------------------- 85
JCSG1488580 86  ----------------------------------------------------- 87
JCSG3179953 186 ----------------------------------------------------- 187
JCSG3179953 90  ----------------------------------------------------- 91
JCSG3229989 185 ----------------------------------------------------- 186
JCSG3229989 89  ----------------------------------------------------- 90
JCSG1673236 201 ----------------------------------------------------- 202
JCSG1673236 105 ----------------------------------------------------- 106
JCSG221025  27  ----------------------------------------------------- 28
JCSG3303684 28  ----------------------------------------------------- 29
JCSG307614  85  ----------------------------------------------------- 86
JCSG302187  128 tgvS--rGvgFIRFdKrIEAEEAIKGLNGQK---------------------- 156
JCSG302187  155 ----------------------------------------------------- 156
JCSG470275  121 ----------------------------------------------------- 122
JCSG1478924 301 ----------------------------------------------------- 302
JCSG1478924 305 ----------------------------------------------------- 306
JCSG1478924 290 ----------------------------------------------------- 291
JCSG1478924 302 ----------------------------------------------------- 303
JCSG3297613 164 ----------------------------------------------------- 165

Note
Homologous search is done using BLAST from NCBI BLAST against database pdbnr with expect (E-value cut-off) at 0.001. The structure of a PDB sequence may be fully or partly solved. The non-redundant database pdbnr consists of unique PDB sequences from the representative PDB chains. Each representative chain has the best structural coverage in the set of the same sequences. You could click a sequence ID to see all of PDB chains associated with the sequence ID plus sequence alignments and structural coverages.



Contact Webmaster JCSG Menu