LOADING...
   BC039315;KN.B21279A.EFCAB6
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
BC039315    PDB Fold Similairty





PDB sequences with significant alignments
Sequence information                                           Score	E-value
JCSG975259|pdb|1WLZ_A|CAP-binding protein complex interact...     202	1e-51
JCSG302258|pdb|1QTX_A|PROTEIN (CALMODULIN)                        49	2e-05
JCSG302257|pdb|1QS7_A|CALMODULIN                                  49	2e-05
JCSG3262418|pdb|4E50_A|Calmodulin, Linker, IQ motif of Neur...    48	4e-05
JCSG219436|pdb|1VRK_A|CALMODULIN                                  48	4e-05
JCSG214722|pdb|1OSA_A|CALMODULIN                                  48	5e-05
JCSG212751|pdb|1CLM_A|CALMODULIN                                  48	5e-05
JCSG3248782|pdb|3SG2_A|myosin light chain kinase, green flu...    45	3e-04
JCSG3293021|pdb|4IK1_A|RCaMP, Green fluorescent protein           45	3e-04
JCSG3248785|pdb|3SG5_A|myosin light chain kinase, green flu...    45	3e-04
JCSG3248784|pdb|3SG4_A|myosin light chain kinase, green flu...    45	3e-04
JCSG302669|pdb|4AQR_A|CALMODULIN-7                                45	3e-04
JCSG3185377|pdb|2L1W_A|Calmodulin                                 45	3e-04
JCSG3248783|pdb|3SG3_A|myosin light chain kinase, green flu...    45	3e-04
JCSG470486|pdb|1XFU_O|Calmodulin 2                                45	4e-04
JCSG210249|pdb|1CKK_A|PROTEIN (CALMODULIN)                        45	4e-04
JCSG3185444|pdb|3O78_A|Chimera protein of Peptide of Myosin...    45	4e-04
JCSG1529965|pdb|2IX7_A|CALMODULIN                                 45	4e-04
JCSG221122|pdb|1WRZ_A|calmodulin                                  45	4e-04
JCSG3283997|pdb|3WFN_B|Calmodulin, Sodium channel protein t...    45	4e-04
...more
PDB sequence alignments
QUERY       588  KESFRDPYSAFFKTDADRDGIINMHDLHRLLLHLLLNLKDDEFERFLGLLGLRLSVTLNF 647
JCSG975259       ------------------------------------------------------------
JCSG302258  12   ---FKEaFSlF---DkDgDGtITtkELgtVMrsLgqNptEaELQdMINeVdadgNgTIDF 65
JCSG302257  9    ---FKEaFSlF---DkDgDGtITtkELgtVMrsLgqNptEaELQdMINeVdadgNgTIDF 62
JCSG3262418 20   ---FKEaFSlF---DkDgDGtITtkELgtVMrsLgqNptEaELQdMINeVdadgNgTIDF 73
JCSG219436  12   ---FKEaFSlF---DkDgDGtITtkELgtVMrsLgqNptEaELQdMINeVdadgNgTIDF 65
JCSG214722  6    EEQIaEfkEAFalfDkDgDGtITtkELgtVMrsLgqNptEaELQdMINeVdadgNgTIDF 65
JCSG212751  6    EEQIaEfkEAFalfDkDgDGtITtkELgtVMrsLgqNptEaELQdMINeVdadgNgTIDF 65
JCSG3248782 315  ---FKEaFSlF---DkDgDGtITtkELgtVMrsLgqNptEaELQdMINeVdadgNgTIDF 368
JCSG3293021 314  ---FKEaFSlF---DkDgDGtITtkELgtVMrsLgqNptEaELQdMINeVdadgDgTIDF 367
JCSG3248785 314  ---FKEaFSlF---DkDgDGtITtkELgtVMrsLgqNptEaELQdMINeVdadgDgTIDF 367
JCSG3248784 314  ---FKEaFSlF---DkDgDGtITtkELgtVMrsLgqNptEaELQdMINeVdadgDgTIDF 367
JCSG302669  13   ---FKEaFSlF---DkDgDGcITtkELgtVMrsLgqNptEaELQdMINeVdadgNgTIDF 66
JCSG3185377 6    EEQIvDfkEAFglfDkDgDGcITVEELatVIrsLdqNptEEELQdMISeVdadgNgTIEF 65
JCSG3248783 315  ---FKEaFSlF---DkDgDGtITtkELgtVMrsLgqNptEaELQdMINeVdadgDgTIDF 368
JCSG470486  13   ---FKEaFSlF---DkDgDGtITtkELgtVMrsLgqNptEaELQdMINeVdadgNgTIDF 66
JCSG210249  12   ---FKEaFSlF---DkDgDGtITtkELgtVMrsLgqNptEaELQdMINeVdadgNgTIDF 65
JCSG3185444 281  ---FKEaFSlF---DkDgDGtITtkELgtVMrsLgqNptEaELQdMINeVdadgNgTIDF 334
JCSG1529965 11   ---FKEaFSlF---DkDgDGtITtkELgtVMrsLgqNptEaELQdMINeVdadgNgTIDF 64
JCSG221122  13   ---FKEaFSlF---DkDgDGtITtkELgtVMrsLgqNptEaELQdMINeVdadgNgTIDF 66
JCSG3283997 19   ---FKEaFSlF---DkDgDGtITtkELgtVMrsLgqNptEaELQdMINeVdadgNgTIDF 72

QUERY       648  REFQNLCEKRPWRTDEAPQRLIRPKQKVADSELACEQAHQYLVTKAKNRWSDLSKNFLET 707
JCSG975259       ------------------------------------------------------------
JCSG302258  66   pEFlNLmaR---------------KMKdTDSE------------------EELKEaFrvf 92
JCSG302257  63   pEFlNLmaR---------------KMKdTDSE------------------EELKEaFrvf 89
JCSG3262418 74   pEFlTMmaR---------------KMKdTDSE------------------EEIrEaFrvf 100
JCSG219436  66   pEFlNLmaR---------------KMKdTDSEeklKEA------------------Frvf 92
JCSG214722  66   pEFlSLmaR---------------KMKeqDSE------------------EELiEaFkvf 92
JCSG212751  66   pEFlSLmaR---------------KMKeqDSE------------------EELiEaFkvf 92
JCSG3248782 369  pEFlTMmaR---------------KMKyTDSE------------------EEIrEaFrvf 395
JCSG3293021 368  pEFlTMmaR---------------KMKyTDSE------------------EEIrEaFrvf 394
JCSG3248785 368  pEFlTMmaR---------------KMKyTDSE------------------EEIrEaFrvf 394
JCSG3248784 368  pEFlTMmaR---------------KMKyTDSE------------------EEIrEaFrvf 394
JCSG302669  67   pEFlNLmaR---------------KMKdTDSE------------------EELKEaFrvf 93
JCSG3185377 66   dEFlSLmaK---------------KvKdTDAE------------------EELKEaFkvf 92
JCSG3248783 369  pEFlTMmaR---------------KMKyTDSE------------------EEIrEaFrvf 395
JCSG470486  67   pEFlTMmaR---------------KMKdTDSE------------------EEIrEaFrvf 93
JCSG210249  66   pEFlTMmaR---------------KMKdTDSE------------------EEIrEaFrvf 92
JCSG3185444 335  pEFlTMmaR---------------KMKdTDSE------------------EEIrEaFrvf 361
JCSG1529965 65   pEFlTMmaR---------------KMKdTDSE------------------EEIrEaFrvf 91
JCSG221122  67   pEFlTMmaR---------------KMKdTDSE------------------EEIrEaFrvf 93
JCSG3283997 73   pEFlTMmaR---------------KMKdTDSE------------------EEIrEaFrvf 99

QUERY       708  DNEGNGILRRRDIKNALYGFDIPLTPREFEKLWARYDTEGKGHITYQEFLQKLGINYSPA 767
JCSG975259       ------------------------------------------------------------
JCSG302258  93   DKDGNGFIsaaELRHVMtNLgekLTdEEvDEMirEaDVDGdGQVNYEEFVQ--------- 143
JCSG302257  90   DKDGNGFIsaaELRHVMtNLgekLTdEEvDEMirEaDVDGdGQVNYEEFVQ--------- 140
JCSG3262418 101  DKDGNGyIsaaELRHVMtNLgekLTdEEvDEMirEaDiDGdGQVNYEEFVQmMtaKgGgG 160
JCSG219436  93   DKDGNGFIsaaELRHVMtNLgekLTdEEvDEMirEaDVDGdGQVNYEEFVQ--------- 143
JCSG214722  93   DRDGNGLIsaaELRHVMtNLgekLTddEvDEMirEaDiDGdGHINYEEFVRmM------- 145
JCSG212751  93   DRDGNGLIsaaELRHVMtNLgekLTddEvDEMirEaDiDGdGHINYEEFVRmM------- 145
JCSG3248782 396  DKDGNGyIsaaELRHVMtNLgekLTdEEvDEMirEaDiDGdGQVNYEEFVQmM------- 448
JCSG3293021 395  DKDGNGyIsaaELRHVMtNLgekLTdEEvDEMirEaDiDGdGQVNYEEFVQmM------- 447
JCSG3248785 395  DKDGNGyIsaaELRHVMtNLgekLTdEEvDEMirEaDiDGdGQVNYEEFVQmM------- 447
JCSG3248784 395  DKDGNGyIsaaELRHVMtNLgekLTdEEvDEMirEaDiDGdGQVNYEEFVQmM------- 447
JCSG302669  94   DKDqNGFIsaaELRHVMtNLgekLTdEEvDEMirEaDVDGdGQINYEEFVK--------- 144
JCSG3185377 93   DKDqNGyIsasELRHVMiNLgekLTdEEvEQMikEaDlDGdGQVNYEEFVKmM------- 145
JCSG3248783 396  DKDGNGyIsaaELRHVMtNLgekLTdEEvDEMirEaDiDGdGQVNYEEFVQmM------- 448
JCSG470486  94   DKDGNGyIsaaELRHVMtNLgekLTdEEvDQMirEaDiDGdGQVNYEEFVQmM------- 146
JCSG210249  93   DKDGNGyIsaaELRHVMtNLgekLTdEEvDEMirEaDiDGdGQVNYEEFVQmM------- 145
JCSG3185444 362  DKDGNGyIsaaELRHVMtNLgekLTdEEvDEMirEaDiDGdGQVNYEEFVQmM------- 414
JCSG1529965 92   DKDGNGyIsaaELRHVMtNLgekLTdEEvDEMirEaDiDGdGQVNYEEFVQmM------- 144
JCSG221122  94   DKDGNGyIsaaELRHVMtNLgekLTdEEvDEMirEaDiDGdGQVNYEEFVQmM------- 146
JCSG3283997 100  DKDGNGyIsaaELRHVMtNLgekLTdEEvDEMirEaDiDGdGQVNYEEFVQmM------- 152

QUERY       768  VHRPCAEDYFNFMGHFTKPQQLQEEMKELQQSTEKAVAARDKLMDRHQDISKAFTKTDQS 827
JCSG975259       ------------------------------------------------------------
JCSG302258  142  ------------------------------------------------------------ 143
JCSG302257  139  ------------------------------------------------------------ 140
JCSG3262418 161  gNaaAAKiqaSFrGHMAR------------------------------------------ 178
JCSG219436  142  ------------------------------------------------------------ 143
JCSG214722  144  ------------------------------------------------------------ 145
JCSG212751  144  ------------------------------------------------------------ 145
JCSG3248782 447  ------------------------------------------------------------ 448
JCSG3293021 446  ------------------------------------------------------------ 447
JCSG3248785 446  ------------------------------------------------------------ 447
JCSG3248784 446  ------------------------------------------------------------ 447
JCSG302669  143  ------------------------------------------------------------ 144
JCSG3185377 144  ------------------------------------------------------------ 145
JCSG3248783 447  ------------------------------------------------------------ 448
JCSG470486  145  ------------------------------------------------------------ 146
JCSG210249  144  ------------------------------------------------------------ 145
JCSG3185444 413  ------------------------------------------------------------ 414
JCSG1529965 143  ------------------------------------------------------------ 144
JCSG221122  145  ------------------------------------------------------------ 146
JCSG3283997 151  ------------------------------------------------------------ 152

QUERY       828  KTNYISICKMQEVLEECGCSLTEGELTHLLNSWGVSRHDNAINYLDFLRAVENSKSTGAQ 887
JCSG975259       ------------------------------------------------------------
JCSG302258  142  ------------------------------------------------------------ 143
JCSG302257  139  ------------------------------------------------------------ 140
JCSG3262418 177  ------------------------------------------------------------ 178
JCSG219436  142  ------------------------------------------------------------ 143
JCSG214722  144  ------------------------------------------------------------ 145
JCSG212751  144  ------------------------------------------------------------ 145
JCSG3248782 447  ------------------------------------------------------------ 448
JCSG3293021 446  ------------------------------------------------------------ 447
JCSG3248785 446  ------------------------------------------------------------ 447
JCSG3248784 446  ------------------------------------------------------------ 447
JCSG302669  143  ------------------------------------------------------------ 144
JCSG3185377 144  ------------------------------------------------------------ 145
JCSG3248783 447  ------------------------------------------------------------ 448
JCSG470486  145  ------------------------------------------------------------ 146
JCSG210249  144  ------------------------------------------------------------ 145
JCSG3185444 413  ------------------------------------------------------------ 414
JCSG1529965 143  ------------------------------------------------------------ 144
JCSG221122  145  ------------------------------------------------------------ 146
JCSG3283997 151  ------------------------------------------------------------ 152

QUERY       888  PKEKEESMPINFATLNPQEVVRKIQEVVESSQLALSTAFSALGKEDTGFVKATEFGQVLK 947
JCSG975259       ------------------------------------------------------------
JCSG302258  142  ------------------------------------------------------------ 143
JCSG302257  139  ------------------------------------------------------------ 140
JCSG3262418 177  ------------------------------------------------------------ 178
JCSG219436  142  ------------------------------------------------------------ 143
JCSG214722  144  ------------------------------------------------------------ 145
JCSG212751  144  ------------------------------------------------------------ 145
JCSG3248782 447  ------------------------------------------------------------ 448
JCSG3293021 446  ------------------------------------------------------------ 447
JCSG3248785 446  ------------------------------------------------------------ 447
JCSG3248784 446  ------------------------------------------------------------ 447
JCSG302669  143  ------------------------------------------------------------ 144
JCSG3185377 144  ------------------------------------------------------------ 145
JCSG3248783 447  ------------------------------------------------------------ 448
JCSG470486  145  ------------------------------------------------------------ 146
JCSG210249  144  ------------------------------------------------------------ 145
JCSG3185444 413  ------------------------------------------------------------ 414
JCSG1529965 143  ------------------------------------------------------------ 144
JCSG221122  145  ------------------------------------------------------------ 146
JCSG3283997 151  ------------------------------------------------------------ 152

QUERY       948  DFCYKLTDNQYHYFLRKLRIHLTPYINWKYFLQNFSCFLEETADEWAEKMPKGPPPTSPK 1007
JCSG975259       ------------------------------------------------------------
JCSG302258  142  ------------------------------------------------------------ 143
JCSG302257  139  ------------------------------------------------------------ 140
JCSG3262418 177  ------------------------------------------------------------ 178
JCSG219436  142  ------------------------------------------------------------ 143
JCSG214722  144  ------------------------------------------------------------ 145
JCSG212751  144  ------------------------------------------------------------ 145
JCSG3248782 447  ------------------------------------------------------------ 448
JCSG3293021 446  ------------------------------------------------------------ 447
JCSG3248785 446  ------------------------------------------------------------ 447
JCSG3248784 446  ------------------------------------------------------------ 447
JCSG302669  143  ------------------------------------------------------------ 144
JCSG3185377 144  ------------------------------------------------------------ 145
JCSG3248783 447  ------------------------------------------------------------ 448
JCSG470486  145  ------------------------------------------------------------ 146
JCSG210249  144  ------------------------------------------------------------ 145
JCSG3185444 413  ------------------------------------------------------------ 414
JCSG1529965 143  ------------------------------------------------------------ 144
JCSG221122  145  ------------------------------------------------------------ 146
JCSG3283997 151  ------------------------------------------------------------ 152

QUERY       1008 ATADRDILARLHKAVTSHYHAITQEFENFDTMKTNTISREEFRAICNRRVQILTDEQFGR 1067
JCSG975259  5    ATADRDILARLHKAVTSHYHAITQEFENFDTMKTNTISREEFRAICNRRVQILTDEQFdR 64
JCSG302258  142  ------------------------------------------------------------ 143
JCSG302257  139  ------------------------------------------------------------ 140
JCSG3262418 177  ------------------------------------------------------------ 178
JCSG219436  142  ------------------------------------------------------------ 143
JCSG214722  144  ------------------------------------------------------------ 145
JCSG212751  144  ------------------------------------------------------------ 145
JCSG3248782 447  ------------------------------------------------------------ 448
JCSG3293021 446  ------------------------------------------------------------ 447
JCSG3248785 446  ------------------------------------------------------------ 447
JCSG3248784 446  ------------------------------------------------------------ 447
JCSG302669  143  ------------------------------------------------------------ 144
JCSG3185377 144  ------------------------------------------------------------ 145
JCSG3248783 447  ------------------------------------------------------------ 448
JCSG470486  145  ------------------------------------------------------------ 146
JCSG210249  144  ------------------------------------------------------------ 145
JCSG3185444 413  ------------------------------------------------------------ 414
JCSG1529965 143  ------------------------------------------------------------ 144
JCSG221122  145  ------------------------------------------------------------ 146
JCSG3283997 151  ------------------------------------------------------------ 152

QUERY       1068 LWNEMPVNAKGRLKYPDFLSRFSSETAATPMATGDSAVAQR 1108
JCSG975259  65   LWNEMPVNAKGRLKYPDFLSRFSSETAATPMATGDSAVAQR 105
JCSG302258  142  ----------------------------------------- 143
JCSG302257  139  ----------------------------------------- 140
JCSG3262418 177  ----------------------------------------- 178
JCSG219436  142  ----------------------------------------- 143
JCSG214722  144  ----------------------------------------- 145
JCSG212751  144  ----------------------------------------- 145
JCSG3248782 447  ----------------------------------------- 448
JCSG3293021 446  ----------------------------------------- 447
JCSG3248785 446  ----------------------------------------- 447
JCSG3248784 446  ----------------------------------------- 447
JCSG302669  143  ----------------------------------------- 144
JCSG3185377 144  ----------------------------------------- 145
JCSG3248783 447  ----------------------------------------- 448
JCSG470486  145  ----------------------------------------- 146
JCSG210249  144  ----------------------------------------- 145
JCSG3185444 413  ----------------------------------------- 414
JCSG1529965 143  ----------------------------------------- 144
JCSG221122  145  ----------------------------------------- 146
JCSG3283997 151  ----------------------------------------- 152

Note
Homologous search is done using BLAST from NCBI BLAST against database pdbnr with expect (E-value cut-off) at 0.001. The structure of a PDB sequence may be fully or partly solved. The non-redundant database pdbnr consists of unique PDB sequences from the representative PDB chains. Each representative chain has the best structural coverage in the set of the same sequences. You could click a sequence ID to see all of PDB chains associated with the sequence ID plus sequence alignments and structural coverages.



Contact Webmaster JCSG Menu