LOADING...
   BC030493;WS20613E
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
BC030493    PDB Fold Similairty





PDB sequences with significant alignments
Sequence information                                           Score	E-value
JCSG3295969|pdb|4OZ0_A|RNA-binding protein 39                     238	4e-63
JCSG3209406|pdb|4J5O_A|RNA-binding protein 39                     237	1e-62
JCSG3191626|pdb|2LQ5_A|RNA-binding protein 39                     237	1e-62
JCSG3303683|pdb|4RU2_K|RNA-binding protein 39 (RBM39)             234	9e-62
JCSG1584842|pdb|2JRS_A|RNA-binding protein 39                     196	2e-50
JCSG1558788|pdb|2DNZ_A|Probable RNA-binding protein 23            156	2e-38
JCSG3304851|pdb|4YUD_A|RNA-binding protein 39                     148	6e-36
JCSG3292344|pdb|2MHN_A|RNA-binding protein 39                     148	6e-36
JCSG976176|pdb|2CQ4_A|RNA binding motif protein 23                137	1e-32
JCSG3179953|pdb|2KXF_A|Poly(U)-binding-splicing factor PUF60      87	1e-17
JCSG3229989|pdb|3UWT_A|Poly(U)-binding-splicing factor PUF60      87	1e-17
JCSG1673236|pdb|2QFJ_B|FBP-interacting repressor                  87	1e-17
JCSG3165256|pdb|3MD3_A|Nuclear and cytoplasmic polyadenylat...    75	9e-14
JCSG3250480|pdb|4F02_A|Polyadenylate-binding protein 1            72	6e-13
JCSG213000|pdb|1CVJ_A|POLYADENYLATE BINDING PROTEIN 1             72	6e-13
JCSG3258820|pdb|2LYV_A|Heterogeneous nuclear ribonucleoprot...    70	2e-12
JCSG234994|pdb|1U1K_A|Heterogeneous nuclear ribonucleoprot...     70	2e-12
JCSG311778|pdb|1PGZ_A|Heterogeneous nuclear ribonucleoprot...     70	2e-12
JCSG307614|pdb|1P1T_A|Cleavage stimulation factor, 64 kDa ...     69	6e-12
JCSG220262|pdb|1PO6_A|Heterogeneous nuclear ribonucleoprot...     69	6e-12
...more
PDB sequence alignments
QUERY       1   MQLAARIRPRDLEEFFSTVGKVRDVRMISDR--NSRRSKGIAYVEFVD-VSSVPLAI-G- 55
JCSG3295969     ------------------------------------------------------------
JCSG3209406     ------------------------------------------------------------
JCSG3191626     ------------------------------------------------------------
JCSG3303683     ------------------------------------------------------------
JCSG1584842     ------------------------------------------------------------
JCSG1558788     ------------------------------------------------------------
JCSG3304851 16  MQLAARIRPRDLEEFFSTVGKVRDVRMISDR--NSRRSKGIAYVEFVD-VSSVPLAI-G- 70
JCSG3292344 18  MQLAARIRPRDLEEFFSTVGKVRDVRMISDR--NSRRSKGIAYVEFVD-VSSVPLAI-G- 72
JCSG976176  31  MQLAARIRPRDLEDFFSAVGKVRDVRIISDR--NSRRSKGIAYVEFcE-IQSVPLAI-G- 85
JCSG3179953 30  -----------IRQaFApfGpIKSIdMswDs--vTmKhKGFAFVEYev-pEAAqLAL-e- 73
JCSG3179953     ------------------------------------------------------------
JCSG3229989 29  -----------IRQaFApfGpIKSIdMswDs--vTmKhKGFAFVEYev-pEAAqLAL-e- 72
JCSG3229989     ------------------------------------------------------------
JCSG1673236 45  -----------IRQaFApfGpIKSIdMswDs--vTmKhKGFAFVEYev-pEAAqLAL-e- 88
JCSG1673236     ------------------------------------------------------------
JCSG3165256 17  -----------LKQYFQVgGpIaNIKIMiDK--NNK-NvNyAFVEYhQ-shDAnIAL-qt 60
JCSG3165256     ------------------------------------------------------------
JCSG3250480 32  -----------LyEkFSpAGpIlSIRVcrDm--iTRRSlGyAYVNFqQ-pADAerAL-d- 75
JCSG3250480     ------------------------------------------------------------
JCSG213000  27  -----------LyEkFSpAGpIlSIRVcrDm--iTRRSlGyAYVNFqQ-pADAerAL-d- 70
JCSG213000      ------------------------------------------------------------
JCSG3258820 31  -----------LRShFEqwGtLtDcvVMrDp--NTKRSRGFGFVtYAt-VEEVdaAM-N- 74
JCSG3258820     ------------------------------------------------------------
JCSG234994  30  -----------LRShFEqwGtLtDcvVMrDp--NTKRSRGFGFVtYAt-VEEVdaAM-N- 73
JCSG234994      ------------------------------------------------------------
JCSG311778  29  -----------LRShFEqwGtLtDcvVMrDp--NTKRSRGFGFVtYAt-VEEVdaAM-N- 72
JCSG311778      ------------------------------------------------------------
JCSG307614      ------------------------------------------------------------
JCSG220262  23  -----------LRShFEqwGtLtDcvVMrDp--NTKRSRGFGFVtYAt-VEEVdaAM-N- 66
JCSG220262      ------------------------------------------------------------

QUERY       56  LTGQRVL-------G-----------V--PIIVQASQAEKNRAAAMANNLQKGSAGP--- 92
JCSG3295969     ------------------------------------------------------------
JCSG3209406     ------------------------------------------------------------
JCSG3191626     ------------------------------------------------------------
JCSG3303683     ------------------------------------------------------------
JCSG1584842 12  ------------------------------------------AAAMANNLQKGSAGP--- 26
JCSG1558788 1   ----------------------------------------------------GSSGs--- 5
JCSG3304851 71  LTGQRVL-------G-----------V--PIIVQASQAEKNR------------------ 92
JCSG3292344 73  LTGQRVL-------G-----------V--PIIVQASQAEKNR------------------ 94
JCSG976176  86  LTGQRLL-------G-----------V--PIIVQASQAEKNR------------------ 107
JCSG3179953 74  qmNSvML-------G-----------g--rnIkvGrpSNiGQAqpIiDQLaEeArAf--- 110
JCSG3179953 2   --------------------------------------------AMAQR-QRAlAim--- 13
JCSG3229989 73  qmNSvML-------G-----------g--rnIkvGrpSNiGQAqpIiDQLaEeArAf--- 109
JCSG3229989 6   --------------------------------------------------QRAlAim--- 12
JCSG1673236 89  qmNSvML-------G-----------g--rnIkvGrpSNiGQAqpIiDQLaEeArAf--- 125
JCSG1673236     ------------------------------------------------------------
JCSG3165256 61  LNGKQIe-------N-----------n----IVKiNwAfQSQ--------QSSSddt--- 87
JCSG3165256     ------------------------------------------------------------
JCSG3250480 76  tmNfdVIk------G-----------k--PVrIMwSQrDpS--------LRKSGVG---- 104
JCSG3250480     ------------------------------------------------------------
JCSG213000  71  tmNfdVIk------G-----------k--PVrIMwSQrDpS--------LRKSGVG---- 99
JCSG213000      ------------------------------------------------------------
JCSG3258820 75  arpHKVd-------G-----------r--vV-------EpKRAVSreDSqRpGAhlt--- 104
JCSG3258820     ------------------------------------------------------------
JCSG234994  74  arpHKVd-------G-----------r--vV-------EpKRAVSreDSqRpGAhlt--- 103
JCSG234994      ------------------------------------------------------------
JCSG311778  73  arpHKVd-------G-----------r--vV-------EpKRAVSreDSqRpGAhlt--- 102
JCSG311778      ------------------------------------------------------------
JCSG307614      ------------------------------------------------------------
JCSG220262  67  arpHKVd-------G-----------r--vV-------EpKRAVSreDSqRpGAhlt--- 96
JCSG220262      ------------------------------------------------------------

QUERY       93  ----M--R-------L-YVGSLHFNITEDMLR----GIFEPFGRI--ES--------IQL 124
JCSG3295969     ------------------------------------------------------------
JCSG3209406     ------------------------------------------------------------
JCSG3191626     ------------------------------------------------------------
JCSG3303683     ------------------------------------------------------------
JCSG1584842 27  ----M--R-------L-YVGSLHFNITEDMLR----GIFEPFGRI--ES--------IQL 58
JCSG1558788 6   ----s--g-------L-YVGSLHFNITEDMLR----GIFEPFGKI--DN--------IvL 37
JCSG3304851 91  ------------------------------------------------------------ 92
JCSG3292344 93  ------------------------------------------------------------ 94
JCSG976176  106 ------------------------------------------------------------ 107
JCSG3179953 111 ----n--R-------I-YVASVHqDLSDDdIK----SVFEaFGKI--KS--------ctL 142
JCSG3179953 14  ----c--R-------V-YVGSIYYELgEDtIR----qaFaPFGpI--KS--------IDM 45
JCSG3229989 110 ----n--R-------I-YVASVHqDLSDDdIK----SVFEaFGKI--KS--------ctL 141
JCSG3229989 13  ----c--R-------V-YVGSIYYELgEDtIR----qaFaPFGpI--KS--------IDM 44
JCSG1673236 126 ----n--R-------I-YVASVHqDLSDDdIK----SVFEaFGKI--KS--------atL 157
JCSG1673236 30  -------R-------V-YVGSIYYELgEDtIR----qaFaPFGpI--KS--------IDM 60
JCSG3165256 88  ----F--N-------L-FVGDLNvNVdDEtLR----NaFKdFpsy--lS--------gHV 119
JCSG3165256 3   ---------------L-YVGNLdkaITEDILK----qyFQvgGpI--aN--------IKI 32
JCSG3250480 105 -------N-------I-FIkNLdkSIdNkaLy----dtFSaFGNI--lS--------cKV 135
JCSG3250480 18  ---------------L-YVGDLHpDVTEaMLy----ekFSPaGpI--lS--------IRV 47
JCSG213000  100 -------N-------I-FIkNLdkSIdNkaLy----dtFSaFGNI--lS--------cKV 130
JCSG213000  13  ---------------L-YVGDLHpDVTEaMLy----ekFSPaGpI--lS--------IRV 42
JCSG3258820 105 ----V--Kk------I-FVGGIkeDteEhhLR----dyFEqYGKI--Ev--------IEI 137
JCSG3258820 16  -------K-------L-FIGGLsFEtTDEsLR----ShFEqWGtL--tD--------cvV 46
JCSG234994  104 ----V--Kk------I-FVGGIkeDteEhhLR----dyFEqYGKI--Ev--------IEI 136
JCSG234994  15  -------K-------L-FIGGLsFEtTDEsLR----ShFEqWGtL--tD--------cvV 45
JCSG311778  103 ----V--Kk------I-FVGGIkeDteEhhLR----dyFEqYGKI--Ev--------IEI 135
JCSG311778  14  -------K-------L-FIGGLsFEtTDEsLR----ShFEqWGtL--tD--------cvV 44
JCSG307614  11  ---------------V-FVGNIpYEaTEEQLK----dIFSevGpV--vS--------FRL 40
JCSG220262  97  ----V--Kk------I-FVGGIkeDteEhhLR----dyFEqYGKI--Ev--------IEI 129
JCSG220262  8   -------K-------L-FIGGLsFEtTDEsLR----ShFEqWGtL--tD--------cvV 38

QUERY       125 MMD---SETG---RSKGYGFITFSD---SECAKKALEQ----LN------G-F--ELAGR 162
JCSG3295969     ------------------------------------------------------------
JCSG3209406     ------------------------------------------------------------
JCSG3191626     ------------------------------------------------------------
JCSG3303683     ------------------------------------------------------------
JCSG1584842 59  MMD---SETG---RSKGYGFITFSD---SECAKKALEQ----LN------G-F--ELAGR 96
JCSG1558788 38  MkD---SDTG---RSKGYGFITFSD---SECARRALEQ----LN------G-F--ELAGR 75
JCSG3304851 91  ------------------------------------------------------------ 92
JCSG3292344 93  ------------------------------------------------------------ 94
JCSG976176  106 ------------------------------------------------------------ 107
JCSG3179953 143 arD---ptTG---KhKGYGFIeYEk---AQsSQdAVSS----MN------l-F--DLGGQ 180
JCSG3179953 46  swD---SvTm---KhKGFAFVeYEv---pEAAQlALEQ----MN------S-v--mLGGR 83
JCSG3229989 142 arD---ptTG---KhKGYGFIeYEk---AQsSQdAVSS----MN------l-F--DLGGQ 179
JCSG3229989 45  swD---SvTm---KhKGFAFVeYEv---pEAAQlALEQ----MN------S-v--mLGGR 82
JCSG1673236 158 arD---ptTG---KhKGYGFIeYEk---AQsSQdAVSS----MN------l-F--DLGGQ 195
JCSG1673236 61  swD---SvTm---KhKGFAFVeYEv---pEAAQlALEQ----MN------S-v--mLGGR 98
JCSG3165256 120 MwD---mQTG---sSRGYGFVSFTS---QDdAQNAMDS----MQ------G-q--DLnGR 157
JCSG3165256 33  MID----KNN---KNvNYAFVeYhQ---SHdANiALQt----LN------G-k--QIeNN 69
JCSG3250480 136 VcD----ENG----SKGYGFVhFEt---QEAAERAIEK----MN------G-M--lLndR 171
JCSG3250480 48  crD---miTr---RSlGYAYVNFQQ---padAERALDt----MN------f-d--vIkGK 85
JCSG213000  131 VcD----ENG----SKGYGFVhFEt---QEAAERAIEK----MN------G-M--lLndR 166
JCSG213000  43  crD---miTr---RSlGYAYVNFQQ---padAERALDt----MN------f-d--vIkGK 80
JCSG3258820 138 MtD---rgSG---KKRGFAFVTFDD---hDsVdKiViQ-----K------y-h--tVnGH 174
JCSG3258820 47  MrD---pNTk---RSRGFGFVTYAt---vEeVdaAM-N----aR------p-h--KVdGR 83
JCSG234994  137 MtD---rgSG---KKRGFAFVTFDD---hDsVdKiViQ-----K------y-h--tVnGH 173
JCSG234994  46  MrD---pNTk---RSRGFGFVTYAt---vEeVdaAM-N----aR------p-h--KVdGR 82
JCSG311778  136 MtD---rgSG---KKRGFAFVTFDD---hDsVdKiViQ-----K------y-h--tVnGH 172
JCSG311778  45  MrD---pNTk---RSRGFGFVTYAt---vEeVdaAM-N----aR------p-h--KVdGR 81
JCSG307614  41  VyD---rETG---KpKGYGFceYQD---QEtAlSAMRN----LN------G-r--EFSGR 78
JCSG220262  130 MtD---rgSG---KKRGFAFVTFDD---hDsVdKiViQ-----K------y-h--tVnGH 166
JCSG220262  39  MrD---pNTk---RSRGFGFVTYAt---vEeVdaAM-N----aR------p-h--KVdGR 75

QUERY       163 PMKVGHVTE--RT--D--AS--SASSFLDSD-ELERTGIDLGTTGR-LQLMA---RLAEG 209
JCSG3295969     ------------------------------------------------------------
JCSG3209406     ------------------------------------------------------------
JCSG3191626     ------------------------------------------------------------
JCSG3303683     ------------------------------------------------------------
JCSG1584842 97  PMKVGHVTE--RT--D-------------------------------------------- 108
JCSG1558788 76  PMRVGHVTE--Rl--D--GG--SGpS---------------------------------- 93
JCSG3304851 91  ------------------------------------------------------------ 92
JCSG3292344 93  ------------------------------------------------------------ 94
JCSG976176  106 ------------------------------------------------------------ 107
JCSG3179953 181 yLRVG------------------------------------------------------- 185
JCSG3179953 84  nIKVG------------------------------------------------------- 88
JCSG3229989 180 yLRVG------------------------------------------------------- 184
JCSG3229989 83  nIKVG------------------------------------------------------- 87
JCSG1673236 196 yLRVG------------------------------------------------------- 200
JCSG1673236 99  nIKVG------------------------------------------------------- 103
JCSG3165256 158 PLRI-------------------------------------------------------- 161
JCSG3165256 70  iVKINwAfQ--sq--Q--SS--SdDTF--------------------------------- 88
JCSG3250480 172 kVfVGRfkS--Rk--E-------------------------------------------- 183
JCSG3250480 86  PVRI-------------------------------------------------------- 89
JCSG213000  167 kVfVGRfkS--Rk--E-------------------------------------------- 178
JCSG213000  81  PVRI-------------------------------------------------------- 84
JCSG3258820 175 ncEVrkAlS--Kq--E--mA--SASS---------------------------------- 192
JCSG3258820 84  vVEpkRAVS--Re--D--SQ--rpGAhLtvk-KIfvgGI--------------------- 113
JCSG234994  174 ncEVrkAlS--Kq--E--mA--SASS---------------------------------- 191
JCSG234994  83  vVEpkRAVS--Re--D--SQ--rpGAhLtvk-KIfvgGI--------------------- 112
JCSG311778  173 ncEVrkAlS--Kq--E--mA--SASS---------------------------------- 190
JCSG311778  82  vVEpkRAVS--Re--D--SQ--rpGAhLtvk-KIfvgGI--------------------- 111
JCSG307614  79  aLRVdNAAS--Ek--N--kE--ElKS---------------------------------- 96
JCSG220262  167 ncEVrkAlS--Kq--E--mA--SAS----------------------------------- 183
JCSG220262  76  vVEpkRAVS--Re--D--SQ--rpGAhLtvk-KIfvgGI--------------------- 105

QUERY       210 TG---LQI-----PPAAQQALQMSGSLAFGAVADLQTRLSQQTEASALAAAASVQPLATQ 261
JCSG3295969 2   ----------------------------------------------------SVQPLATQ 9
JCSG3209406 2   -----------------------------------------------------VQPLATQ 8
JCSG3191626 1   -----------------------------------------------------VQPLATQ 7
JCSG3303683 2   -----------------------------------------------------VQPLATQ 8
JCSG1584842 107 ------------------------------------------------------------ 108
JCSG1558788 92  ------------------------------------------------------------ 93
JCSG3304851 91  ------------------------------------------------------------ 92
JCSG3292344 93  ------------------------------------------------------------ 94
JCSG976176  106 ------------------------------------------------------------ 107
JCSG3179953 184 ------------------------------------------------------------ 185
JCSG3179953 87  ------------------------------------------------------------ 88
JCSG3229989 183 ------------------------------------------------------------ 184
JCSG3229989 86  ------------------------------------------------------------ 87
JCSG1673236 199 ------------------------------------------------------------ 200
JCSG1673236 102 ------------------------------------------------------------ 103
JCSG3165256 160 ------------------------------------------------------------ 161
JCSG3165256 87  ------------------------------------------------------------ 88
JCSG3250480 182 ------------------------------------------------------------ 183
JCSG3250480 88  ------------------------------------------------------------ 89
JCSG213000  177 ------------------------------------------------------------ 178
JCSG213000  83  ------------------------------------------------------------ 84
JCSG3258820 191 ------------------------------------------------------------ 192
JCSG3258820 112 ------------------------------------------------------------ 113
JCSG234994  190 ------------------------------------------------------------ 191
JCSG234994  111 ------------------------------------------------------------ 112
JCSG311778  189 ------------------------------------------------------------ 190
JCSG311778  110 ------------------------------------------------------------ 111
JCSG307614  95  ------------------------------------------------------------ 96
JCSG220262  182 ------------------------------------------------------------ 183
JCSG220262  104 ------------------------------------------------------------ 105

QUERY       262 CFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGV--IHIYVDKNSAQGN------VYV 313
JCSG3295969 10  CFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGV--IHIYVDKNSAQGN------VYV 61
JCSG3209406 9   CFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGV--IHIYVDKNSAQGN------VYV 60
JCSG3191626 8   CFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGV--IHIYVDKNSAQGN------VYV 59
JCSG3303683 9   CFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGV--IHIYVDKySAQGN------VYV 60
JCSG1584842 107 ------------------------------------------------------------ 108
JCSG1558788 92  ------------------------------------------------------------ 93
JCSG3304851 91  ------------------------------------------------------------ 92
JCSG3292344 93  ------------------------------------------------------------ 94
JCSG976176  106 ------------------------------------------------------------ 107
JCSG3179953 184 ------------------------------------------------------------ 185
JCSG3179953 87  ------------------------------------------------------------ 88
JCSG3229989 183 ------------------------------------------------------------ 184
JCSG3229989 86  ------------------------------------------------------------ 87
JCSG1673236 199 ------------------------------------------------------------ 200
JCSG1673236 102 ------------------------------------------------------------ 103
JCSG3165256 160 ------------------------------------------------------------ 161
JCSG3165256 87  ------------------------------------------------------------ 88
JCSG3250480 182 ------------------------------------------------------------ 183
JCSG3250480 88  ------------------------------------------------------------ 89
JCSG213000  177 ------------------------------------------------------------ 178
JCSG213000  83  ------------------------------------------------------------ 84
JCSG3258820 191 ------------------------------------------------------------ 192
JCSG3258820 112 ------------------------------------------------------------ 113
JCSG234994  190 ------------------------------------------------------------ 191
JCSG234994  111 ------------------------------------------------------------ 112
JCSG311778  189 ------------------------------------------------------------ 190
JCSG311778  110 ------------------------------------------------------------ 111
JCSG307614  95  ------------------------------------------------------------ 96
JCSG220262  182 ------------------------------------------------------------ 183
JCSG220262  104 ------------------------------------------------------------ 105

QUERY       314 KCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR 367
JCSG3295969 62  KCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR 115
JCSG3209406 61  KCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR 114
JCSG3191626 60  KCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR 113
JCSG3303683 61  KCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR 114
JCSG1584842 107 ------------------------------------------------------ 108
JCSG1558788 92  ------------------------------------------------------ 93
JCSG3304851 91  ------------------------------------------------------ 92
JCSG3292344 93  ------------------------------------------------------ 94
JCSG976176  106 ------------------------------------------------------ 107
JCSG3179953 184 ------------------------------------------------------ 185
JCSG3179953 87  ------------------------------------------------------ 88
JCSG3229989 183 ------------------------------------------------------ 184
JCSG3229989 86  ------------------------------------------------------ 87
JCSG1673236 199 ------------------------------------------------------ 200
JCSG1673236 102 ------------------------------------------------------ 103
JCSG3165256 160 ------------------------------------------------------ 161
JCSG3165256 87  ------------------------------------------------------ 88
JCSG3250480 182 ------------------------------------------------------ 183
JCSG3250480 88  ------------------------------------------------------ 89
JCSG213000  177 ------------------------------------------------------ 178
JCSG213000  83  ------------------------------------------------------ 84
JCSG3258820 191 ------------------------------------------------------ 192
JCSG3258820 112 ------------------------------------------------------ 113
JCSG234994  190 ------------------------------------------------------ 191
JCSG234994  111 ------------------------------------------------------ 112
JCSG311778  189 ------------------------------------------------------ 190
JCSG311778  110 ------------------------------------------------------ 111
JCSG307614  95  ------------------------------------------------------ 96
JCSG220262  182 ------------------------------------------------------ 183
JCSG220262  104 ------------------------------------------------------ 105

Note
Homologous search is done using BLAST from NCBI BLAST against database pdbnr with expect (E-value cut-off) at 0.001. The structure of a PDB sequence may be fully or partly solved. The non-redundant database pdbnr consists of unique PDB sequences from the representative PDB chains. Each representative chain has the best structural coverage in the set of the same sequences. You could click a sequence ID to see all of PDB chains associated with the sequence ID plus sequence alignments and structural coverages.



Contact Webmaster JCSG Menu