LOADING...
   BC011707;KN.B21268A.NRBF2
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
BC011707    PDB Fold Similairty





PDB sequences with significant alignments
Sequence information                                           Score	E-value
JCSG976208|pdb|2CRB_A|nuclear receptor binding factor 2           157	8e-39
PDB sequence alignments
QUERY      4  MEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDS 63
JCSG976208 8  MEGPLNLAHQQSRRADRLLAAGKYEEAISCHRKATTYLSEAMKLTESEQAHLSLELQRDS 67

QUERY      64 HMKQLLLIQERWKRAQREERLKA 86
JCSG976208 68 HMKQLLLIQERWKRAKREERLKA 90

Note
Homologous search is done using BLAST from NCBI BLAST against database pdbnr with expect (E-value cut-off) at 0.001. The structure of a PDB sequence may be fully or partly solved. The non-redundant database pdbnr consists of unique PDB sequences from the representative PDB chains. Each representative chain has the best structural coverage in the set of the same sequences. You could click a sequence ID to see all of PDB chains associated with the sequence ID plus sequence alignments and structural coverages.



Contact Webmaster JCSG Menu