LOADING...
   BC011564;RF20603A.DAX1
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
BC011564    PDB Fold Similairty





PDB sequences with significant alignments
Sequence information                                           Score	E-value
JCSG2885384|pdb|3F5C_B|Nuclear receptor subfamily 0 group B...    359	2e-99
JCSG3292860|pdb|4NUF_A|Maltose ABC transporter periplasmic ...    136	3e-32
JCSG3187769|pdb|3P0U_A|Nuclear receptor subfamily 2 group C...    85	9e-17
JCSG3286020|pdb|4LOG_A|Maltose ABC transporter periplasmic ...    81	2e-15
JCSG2879419|pdb|3CJW_A|COUP transcription factor 2                79	8e-15
JCSG480217|pdb|1Z5X_U|Ultraspiracle protein (USP) a homolo...     75	7e-14
JCSG3297941|pdb|4OZT_U|Retinoid X receptor                        74	2e-13
JCSG1660823|pdb|2NXX_B|Ultraspiracle (USP, NR2B4)                 74	3e-13
JCSG3297939|pdb|4OZR_U|Retinoid X receptor                        74	3e-13
JCSG3262455|pdb|4IQR_F|Hepatocyte nuclear factor 4-alpha          69	9e-12
JCSG449464|pdb|1PZL_A|Hepatocyte nuclear factor 4-alpha           69	9e-12
JCSG3284800|pdb|4B7W_A|HEPATOCYTE NUCLEAR FACTOR 4-ALPHA          69	9e-12
JCSG3086567|pdb|3FS1_A|Hepatocyte nuclear factor 4-alpha          69	9e-12
JCSG2882012|pdb|3EYB_A|Nuclear hormone receptor RXR               66	6e-11
JCSG975321|pdb|1XIU_B|RXR-like protein                            66	6e-11
JCSG449495|pdb|1UHL_A|Retinoic acid receptor RXR-beta             66	6e-11
JCSG3186063|pdb|3A9E_A|Retinoic acid receptor RXR-alpha           65	7e-11
JCSG3299996|pdb|4OC7_A|Retinoic acid receptor RXR-alpha           65	7e-11
JCSG2986536|pdb|3E94_A|Retinoic acid receptor RXR-alpha           65	7e-11
JCSG3246352|pdb|3UVV_B|Retinoic acid receptor RXR-alpha           65	7e-11
...more
PDB sequence alignments
QUERY       203 GEDHPQQGSTLYCVPTSTNQAQAAPEERPRAPWWDTSSGALRPVALKSPQV-VCEAASAG 261
JCSG2885384 1   GEEQPQQiSVasgTPVSADQTpATPQEQPRAPWWDASpGVqRlITLKDPQV-VCEAASAG 59
JCSG3292860 336 ----PQMSAfwYAVrTAViNAaSGrQtvdEA-----lKdAqtnAAaEfPHr-TCReAldv 385
JCSG3187769 39  ----------------------------------------------------ICESASrl 46
JCSG3286020 336 ----PQMSAfwYAVrTAViNAaSGrQtvdEA-----lKdAqtnAAaEflDs-IhETSArl 385
JCSG2879419 28  -------------------------------------SqCMQPnnImGiEn-ICElAArm 49
JCSG480217  69  ----------------------------------------------------ICQAADrq 76
JCSG3297941 6   ----------------------------------------------------ICQATNSq 13
JCSG1660823 42  ----------------------------------------------------ICQAThkq 49
JCSG3297939 8   ----------------------------------------------------ICQATNTq 15
JCSG3262455 134 -------------------------------------NGdIRakkIaSiad-VCESmKeq 155
JCSG449464  32  -------------------------------------NGdIRakkIaSiad-VCESmKeq 53
JCSG3284800 35  -------------------------------------NGdIRakkIaSiad-VCESmKeq 56
JCSG3086567 26  -------------------------------------NGdIRakkIaSiad-VCESmKeq 47
JCSG2882012 32  ----------------------------------------------------ICQAADkq 39
JCSG975321  36  ----------------------------------------------------ICQAADkq 43
JCSG449495  42  ----------------------------------------------------ICQAADkq 49
JCSG3186063 15  -------------------EAElAvE--PKTetYveANmGLNPsSpNDPvTnICQAADkq 53
JCSG3299996 29  -------------------EAElAvE--PKTetYveANmGLNPsSpNDPvTnICQAADkq 67
JCSG2986536 19  -------------------EAElAvE--PKTetYveANmGLNPsSpNDPvTnICQAADkq 57
JCSG3246352 17  -------------------EAElAvE--PKTetYveANmGLNPsSpNDPvTnICQAADkq 55

QUERY       262 LLKTLRFVKYLPCFQVLPLDQQLVLVRNCWASLLMLELAQD-RLQFETVEVSEPSM---- 316
JCSG2885384 60  LLKTLRFVKYLPCFQILPLDQQLVLVRSCWApLLMLELAQD-HLHFEmMEIpEtNt---- 114
JCSG3292860 386 LaKTVaFLRnLPsFchLPhDDQrrLLEcCWGpLFLLgLAQD-aVtFEVAEApvPSI---- 440
JCSG3187769 47  LFlSMHWARsIPAFQALgqDcNtsLVRaCWnELFtLgLAQ-------cAQVmSlSt---- 95
JCSG3286020 386 LFmAVKWAKnLPvFSsLPFrDQVILLEEAWSELFLLgaiQw-sLpLDScpLlaPp----- 439
JCSG2879419 50  LFSAVEWARnIPfFpdLqItDQVALLRltWSELFVLNaAQc-sMpLHVApLlaaAg---- 104
JCSG480217  77  LyQlIEWAKHIPhFteLPVEDQVILLKSgWnELLIagFSH------RSMSVKDgiM---- 126
JCSG3297941 14  LyQlVEWAKHIPhFSsLPIEDQVLLLRagWnELLIaaFSH------RSVEVrDgiV---- 63
JCSG1660823 50  LFQlVQWAKlVPhFtsLPLtDQVqLLRagWnELLIaaFSHr-sMQaQdAiVlatGL---- 104
JCSG3297939 16  LyQlVEWAKHIPhFSsLPIEDQVLLLRagWnELLIaaFSH------RSVEVrDgiV---- 65
JCSG3262455 156 LLvlVEWAKYIPAFceLPLDDQVALLRahaGEhLLLgaTKr-sMvFKdVlLl-------- 206
JCSG449464  54  LLvlVEWAKYIPAFceLPLDDQVALLRahaGEhLLLgaTKr-sMvFKdVlLl-------- 104
JCSG3284800 57  LLvlVEWAKYIPAFceLPLDDQVALLRahaGEhLLLgaTKr-sMvFKdVlLl-------- 107
JCSG3086567 48  LLvlVEWAKYIPAFceLPLDDQVALLRahaGEhLLLgaTKr-sMvFKdVlLl-------- 98
JCSG2882012 40  LVtlVEWAKrIPhFSdLPIDDQVILLRagWnELLIaaFSH------RSIDVKDgiL---- 89
JCSG975321  44  LFtlVEWAKrIPhFteLPLEDQVILLRagWnELLIagFSH-------------------- 83
JCSG449495  50  LFtlVEWAKrIPhFSsLPLDDQVILLRagWnELLIaSFSH------RSIDVrDgiL---- 99
JCSG3186063 54  LFtlVEWAKrIPhFSeLPLDDQVILLRagWnELLIaSFSH------RSIaVKDgiL---- 103
JCSG3299996 68  LFtlVEWAKrIPhFSeLPLDDQVILLRagWnELLIaSFSH------RSIaVKDgiL---- 117
JCSG2986536 58  LFtlVEWAKrIPhFSeLPLDDQVILLRagWnELLIaSFSH------RSIaVKDgiL---- 107
JCSG3246352 56  LFtlVEWAKrIPhFSeLPLDDQVILLRagWnELLIaSFSH------RSIaVKDgiL---- 105

QUERY       317 --LQKILTTRRRE-TGGNEPL---PVPTLQHHLAPPAEARKVPSASQVQAIKCFLS-KCW 369
JCSG2885384 115 --tQEMLTTRRQE-TeGpEPa---epqAtEQpqmvsAEAghLlpAAaVQAIKsFFf-KCW 167
JCSG3292860 441 --LKKILTTRasSgTqGaQPs---drPq--------------PSlAaVQwLQrcLE-SfW 480
JCSG3187769 96  --IlaaIVNHlQN-SiqEDkL---sgdrIKQvM------------EHIwkLQeFcN-Sma 136
JCSG3286020 440 -----------------------------EasaAggAQGRlTlASmETRVLQetIS-Rfr 469
JCSG2879419 105 --L----------------------------HaSPmSadRvVafmDHIRiFQeqVE-Klk 133
JCSG480217  127 --LatgLVVHRN----------------caHQaGvgAifdRVlTe--------LVA-Kmr 159
JCSG3297941 64  --LgagITVHRNS-A---------------HQaGvgTifdRVlTe--------LVA-Kmr 96
JCSG1660823 105 --tvNksTAHavg-VGNiydr---vLseL-------------------------VN-Kmk 132
JCSG3297939 66  --LgagITVHRNS-A---------------HQaGvgTifdRVlTe--------LVA-Kmr 98
JCSG3262455 207 ----------------GNDyI-------VpRHcpelAEmsRV----SIRiLdeLVl-pfq 238
JCSG449464  105 ----------------GNDyI-------VpRHcpelAEmsRV----SIRiLdeLVl-pfq 136
JCSG3284800 108 ----------------GNDyI-------VpRHcpelAEmsRV----SIRiLdeLVl-pfq 139
JCSG3086567 99  ----------------GNDyI-------VpRHcpelAEmsRV----SIRiLdeLVl-pfq 130
JCSG2882012 90  --LaSgLhVHRsS-A---------------HQaGvgTifdRVlTe--------LVA-Kmr 122
JCSG975321  84  -----------RS-imAKDgI---lLaTglHvhrssAHqagVgTifD-RVLteLVA-Kmr 126
JCSG449495  100 --LatgLhVHRNS-A---------------HsaGvgAifdRVlTe--------LVS-Kmr 132
JCSG3186063 104 --LatgLhVHRNS-A---------------HsaGvgAifdRVlTe--------LVS-Kmr 136
JCSG3299996 118 --LatgLhVHRNS-A---------------HsaGvgAifdRVlTe--------LVS-Kmr 150
JCSG2986536 108 --LatgLhVHRNS-A---------------HsaGvgAifdRVlTe--------LVS-Kmr 140
JCSG3246352 106 --LatgLhVHRNS-A---------------HsaGvgAifdRVlTe--------LVS-Kmr 138

QUERY       370 SLNISTKEYAYLKGTVLF-----------N--PDVPGLQCVKY-----IQGLQWGTQQIL 411
JCSG2885384 168 SLNIDTKEYAYLKGTVLF-----------N--PDLPGLQCVKY-----IEGLQWrTQQIL 209
JCSG3292860 481 SLELGpKEYAYLKGTILF-----------N--PDVPGLRAscH-----IahLQqeAHwaL 522
JCSG3187769 137 KLDIDgyEYAYLKAiVLF-----------S--PDhPGLtsTSq-----IEkFQeAAQMeL 178
JCSG3286020 470 ALaVDptEFAcMKAlVLF-----------K--PETrGLKdpEH-----VEALQdqSQvML 511
JCSG2879419 134 ALHVDSaEYScLKAiVLF-----------T--sDAcGLSdVaH-----VESLQekSQcaL 175
JCSG480217  160 EMKMDktElGcLRSiVLF-----------N--PEAkGLKsTQq-----VENLRekVyaIL 201
JCSG3297941 97  DMNMDrtElGsLRSiILF-----------N--PEVrGLKsgQe-----VElLRekVyaaL 138
JCSG1660823 133 EMKMDktElGcLRAiILY-----------N--PDVrGIKsVQe-----VEmLRekiygVL 174
JCSG3297939 99  DMNMDrtElGsLRSiILF-----------N--PEVrGLKsgQe-----VElLRekVyaaL 140
JCSG3262455 239 ELQIDdNEYAYLKAiIFF-----------D--PDAkGLSdpgk-----IKrLRsqVQvsL 280
JCSG449464  137 ELQIDdNEYAYLKAiIFF-----------D--PDAkGLSdpgk-----IKrLRsqVQvsL 178
JCSG3284800 140 ELQIDdNEYAYLKAiIFF-----------D--PDAkGLSdpgk-----IKrLRsqVQvsL 181
JCSG3086567 131 ELQIDdNEYAYLKAiIFF-----------D--PDAkGLSdpgk-----IKrLRsqVQvsL 172
JCSG2882012 123 DMKMDktElGcLRAiVLF-----------N--PDAkGLtdpSl-----VESLRekVyasL 164
JCSG975321  127 DMKMDktElGcLRAVVLF-----------N--PDAkGLtAVQe-----VEqLRekVyasL 168
JCSG449495  133 DMRMDktElGcLRAiILF-----------N--PDAkGLSnpSe-----VEvLRekVyasL 174
JCSG3186063 137 DMQMDktElGcLRAiVLF-----------N--PDskGLSnpae-----VEALRekVyasL 178
JCSG3299996 151 DMQMDktElGcLRAiVLF-----------N--PDskGLSnpae-----VEALRekVyasL 192
JCSG2986536 141 DMQMDktElGcLRAiVLF-----------N--PDskGLSnpae-----VEALRekVyasL 182
JCSG3246352 139 DMQMDktElGcLRAiVLF-----------N--PDskGLSnpae-----VEALRekVyasL 180

QUERY       412 SEHTRMTHQGPHDRF---IELNSTLFLLRFINANVIAELFFRPIIGTVSMDDMMLEMLCT 468
JCSG2885384 210 TEHiRMmQReyQiRs---aELNSALFLLRFINSDVVTELFFRPIIGAVSMDDMMLEMLCA 266
JCSG3292860 523 cEvlEpwYpAsQgRL---aRIllmastLRnIpGTLLVDLFFRPIMGdVDItELLeDML-- 577
JCSG3187769 179 QDYVQaTYSedtyRL---aRIlvrLpaLRLMSSNIteELFFtgLIGNVSIDSII------ 229
JCSG3286020 512 SQHSKahHpSqpvRF---gKLlllLpsLRFITAErIelLFFRktIGNTpMEkLLsDM--- 565
JCSG2879419 176 EEYVRsqYpNqptRF---gKLllrLpsLRtVSSSVIeQLFFvrLVGkTpIEtLIrDML-- 230
JCSG480217  202 EEYcRQTYpdqsgRF---aKLllrLpaLRsIGlKcLeHLFFfkLVGNTSIDSFLLSML-- 256
JCSG3297941 139 EEYTRVTRpeepgRF---aKLllrLpaLRsIGlKcLeHLFFfkLIGdIpIDtFLMDML-- 193
JCSG1660823 175 EEYTRtTHpNepgRF---aKLllrLpaLRsIGlKcLeHLFFfkLIGdVpIDtFLMEML-- 229
JCSG3297939 141 EEYTRVTRpeepgRF---aKLllrLpaLRsIGlKcLeHLFFfrLIGdIpIDtFLMDML-- 195
JCSG3262455 281 EDYiNdrQydsRgRF---gELlllLptLQsITwQMIeQIqFikLFGmAKIDNLLqEML-- 335
JCSG449464  179 EDYiNdrQydsRgRF---gELlllLptLQsITwQMIeQIqFikLFGmAKIDNLLqEML-- 233
JCSG3284800 182 EDYiNdrQydsRgRF---gELlllLptLQsITwQMIeQIqFikLFGmAKIDNLLqEML-- 236
JCSG3086567 173 EDYiNdrQydsRgRF---gELlllLptLQsITwQMIeQIqFikLFGmAKIDNLLqEML-- 227
JCSG2882012 165 EEYcKQqYpeqpgRF---aKLllrLpaLRsIGlKcLeHLFFfkLIGdTpIDtFLMEML-- 219
JCSG975321  169 EEYTKsrYpeepgRF---aKLllrLpaLRsIGlKcLeHLFFfkLIGdqpIDtFLMEML-- 223
JCSG449495  175 EtYcKQkYpeqQgRF---aKLllrLpaLRsIGlKcLeHLFFfkLIGdTpIDtFLMEML-- 229
JCSG3186063 179 EaYcKhkYpeqpgRF---aKLllrLpaLRsIGlKcLeHLFFfkLIGdTpIDtFLMEML-- 233
JCSG3299996 193 EaYcKhkYpeqpgRF---aKLllrLpaLRsIGlKcLeHLFFfkLIGdTpIDtFLMEML-- 247
JCSG2986536 183 EaYcKhkYpeqpgRF---aKLllrLpaLRsIGlKcLeHLFFfkLIGdTpIDtFLMEML-- 237
JCSG3246352 181 EaYcKhkYpeqpgRF---aKLllrLpaLRsIGlKcLeHLFFfkLIGdTpIDtFLMEML-- 235

QUERY       469 KI 470
JCSG2885384 267 KL 268
JCSG3292860 576 -- 577
JCSG3187769 228 -- 229
JCSG3286020 564 -- 565
JCSG2879419 229 -- 230
JCSG480217  255 -- 256
JCSG3297941 192 -- 193
JCSG1660823 228 -- 229
JCSG3297939 194 -- 195
JCSG3262455 334 -- 335
JCSG449464  232 -- 233
JCSG3284800 235 -- 236
JCSG3086567 226 -- 227
JCSG2882012 218 -- 219
JCSG975321  222 -- 223
JCSG449495  228 -- 229
JCSG3186063 232 -- 233
JCSG3299996 246 -- 247
JCSG2986536 236 -- 237
JCSG3246352 234 -- 235

Note
Homologous search is done using BLAST from NCBI BLAST against database pdbnr with expect (E-value cut-off) at 0.001. The structure of a PDB sequence may be fully or partly solved. The non-redundant database pdbnr consists of unique PDB sequences from the representative PDB chains. Each representative chain has the best structural coverage in the set of the same sequences. You could click a sequence ID to see all of PDB chains associated with the sequence ID plus sequence alignments and structural coverages.



Contact Webmaster JCSG Menu