LOADING...
   AF124247;AF124247
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
AF124247    PDB Fold Similairty





PDB sequences with significant alignments
Sequence information                                           Score	E-value
JCSG3228871|pdb|3TX7_B|Nuclear receptor subfamily 5 group A...    701	0.0
JCSG479529|pdb|1YUC_A|Orphan nuclear receptor NR5A2               502	e-142
JCSG3303764|pdb|4ONI_B|Nuclear receptor subfamily 5 group A...    499	e-141
JCSG3302959|pdb|4RWV_A|Nuclear receptor subfamily 5 group A...    492	e-139
JCSG486407|pdb|1ZDU_A|Orphan nuclear receptor NR5A2               487	e-138
JCSG3199926|pdb|3PLZ_B|FTZ-F1 related protein                     481	e-136
JCSG493339|pdb|1YOK_A|Orphan nuclear receptor NR5A2               481	e-136
JCSG3246385|pdb|4DOS_A|Nuclear receptor subfamily 5 group A...    477	e-135
JCSG3280448|pdb|4IS8_A|Nuclear receptor subfamily 5 group A...    464	e-131
JCSG302313|pdb|1PK5_A|Orphan nuclear receptor NR5A2               441	e-124
JCSG975436|pdb|1ZH7_A|Orphan nuclear receptor NR5A2               433	e-121
JCSG3297975|pdb|4QJR_A|Steroidogenic factor 1                     298	6e-81
JCSG486406|pdb|1ZDT_B|Steroidogenic factor 1                      298	8e-81
JCSG485253|pdb|1YOW_A|Steroidogenic factor 1                      296	3e-80
JCSG480303|pdb|1YP0_A|nuclear receptor subfamily 5, group ...     293	2e-79
JCSG479653|pdb|1YMT_A|Steroidogenic factor 1                      288	6e-78
JCSG2884071|pdb|3F7D_A|nuclear receptor SF-1                      288	8e-78
JCSG976373|pdb|2A66_A|Orphan nuclear receptor NR5A2               235	5e-62
JCSG1476363|pdb|2FF0_A|Steroidogenic factor 1                     208	8e-54
JCSG478573|pdb|1YNW_A|Vitamin D3 Receptor                         92	9e-19
...more
PDB sequence alignments
QUERY       78  YDEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQN--N--K-RY-TCIENQNCQID 131
JCSG3228871     ------------------------------------------------------------
JCSG479529      ------------------------------------------------------------
JCSG3303764     ------------------------------------------------------------
JCSG3302959     ------------------------------------------------------------
JCSG486407      ------------------------------------------------------------
JCSG3199926     ------------------------------------------------------------
JCSG493339      ------------------------------------------------------------
JCSG3246385     ------------------------------------------------------------
JCSG3280448     ------------------------------------------------------------
JCSG302313      ------------------------------------------------------------
JCSG975436      ------------------------------------------------------------
JCSG3297975     ------------------------------------------------------------
JCSG486406      ------------------------------------------------------------
JCSG485253      ------------------------------------------------------------
JCSG480303      ------------------------------------------------------------
JCSG479653      ------------------------------------------------------------
JCSG2884071     ------------------------------------------------------------
JCSG976373  5   -DEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQN--N--K-RY-TCIENQNCQID 57
JCSG1476363 1   -----DELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQN--N--K-HY-TCtESQSCKID 49
JCSG478573  1   FDRNVpRICgVCGDRATGFHFNaMTCEGCKGFFRRSMKR--K--a-lF-TCaaNgDCRIt 54

QUERY       132 KTQRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQQKKALIRANGL 191
JCSG3228871 2   -----------------------------------------------------------L 2
JCSG479529      ------------------------------------------------------------
JCSG3303764     ------------------------------------------------------------
JCSG3302959     ------------------------------------------------------------
JCSG486407      ------------------------------------------------------------
JCSG3199926     ------------------------------------------------------------
JCSG493339      ------------------------------------------------------------
JCSG3246385     ------------------------------------------------------------
JCSG3280448     ------------------------------------------------------------
JCSG302313      ------------------------------------------------------------
JCSG975436      ------------------------------------------------------------
JCSG3297975     ------------------------------------------------------------
JCSG486406      ------------------------------------------------------------
JCSG485253      ------------------------------------------------------------
JCSG480303      ------------------------------------------------------------
JCSG479653      ------------------------------------------------------------
JCSG2884071     ------------------------------------------------------------
JCSG976373  58  KTQRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQQKKALIR---- 113
JCSG1476363 50  KTQRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQKKA------- 102
JCSG478573  55  KdNRRaCqaCRLKRCVDIGMmkEfIlTDEevqrKREMilkrKEEEALK------------ 102

QUERY       192 KLEAMSQVIQAMPSDLTISSAIQNIH-SASKGLPLN----HAALPPTDYDRSPFVTSPIS 246
JCSG3228871 3   KLEAMSQVIQAMPSDLTISSAIQNIH-SASKGLPLN----HAALPPTDYDRSPFVTSPIS 57
JCSG479529      ------------------------------------------------------------
JCSG3303764     ------------------------------------------------------------
JCSG3302959     ------------------------------------------------------------
JCSG486407      ------------------------------------------------------------
JCSG3199926     ------------------------------------------------------------
JCSG493339      ------------------------------------------------------------
JCSG3246385     ------------------------------------------------------------
JCSG3280448     ------------------------------------------------------------
JCSG302313      ------------------------------------------------------------
JCSG975436      ------------------------------------------------------------
JCSG3297975     ------------------------------------------------------------
JCSG486406      ------------------------------------------------------------
JCSG485253      ------------------------------------------------------------
JCSG480303      ------------------------------------------------------------
JCSG479653      ------------------------------------------------------------
JCSG2884071     ------------------------------------------------------------
JCSG976373  112 ------------------------------------------------------------ 113
JCSG1476363 101 ------------------------------------------------------------ 102
JCSG478573  101 ------------------------------------------------------------ 102

QUERY       247 MTMPPHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSP--ASIPH- 303
JCSG3228871 58  MTMPPHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSP--ASIPH- 114
JCSG479529  3   ------------------------------------------FMDSYQTSSP--ASIPH- 17
JCSG3303764 3   --------------------------------------------DSYQTSSP--ASIPH- 15
JCSG3302959 2   -----------------------------------------------QTSSP--ASIPH- 11
JCSG486407  1   --------------------------------------------------SP--ASIPH- 7
JCSG3199926 16  -------------------------------------------------------SIPH- 19
JCSG493339  15  -------------------------------------------------------SIPH- 18
JCSG3246385 3   ------------------------------------------------------ASIPH- 7
JCSG3280448 1   -------------------------------------------------------SIPH- 4
JCSG302313  1   -----------------------------------------------QTNSP--ASIPH- 10
JCSG975436  1   ------------------------------------------------------ASIPH- 5
JCSG3297975 2   -------------------------------------------------SGg--pNVPE- 9
JCSG486406  2   -------------------------------------------------------NVPE- 5
JCSG485253  2   ------------------------------------------------------SNVPE- 6
JCSG480303  1   -------------------------------------------------------NVPE- 4
JCSG479653  2   ------------------------------------------------SSGg--pNVPE- 10
JCSG2884071 1   -------------------------------------------------SGg--pNVPE- 8
JCSG976373  112 ------------------------------------------------------------ 113
JCSG1476363 101 ------------------------------------------------------------ 102
JCSG478573  101 ------------------------------------------------------------ 102

QUERY       304 -LILELLKCEPDEPQVQAKI-MAYLQQEQANR-------------------SKHEKLSTF 342
JCSG3228871 115 -LILELLKCEPDEPQVQAKI-MAYLQQEQANR-------------------SKHEKLSTF 153
JCSG479529  18  -LILELLKCEPDEPQVQAKI-MAYLQQEQANR-------------------SKHEKLSTF 56
JCSG3303764 16  -LILELLKCEPDEPQVQAKI-MAYLQQEQANR-------------------SKHEKLSTF 54
JCSG3302959 12  -LILELLKCEPDEPQVQAKI-MAYLQQEQANR-------------------SKHEKLSTF 50
JCSG486407  8   -LILELLKCEPDEPQVQAKI-MAYLQQEQANR-------------------SKHEKLSTF 46
JCSG3199926 20  -LILELLKCEPDEPQVQAKI-MAYLQQEQANR-------------------SKHEKLSTF 58
JCSG493339  19  -LILELLKCEPDEPQVQAKI-MAYLQQEQANR-------------------SKHEKLSTF 57
JCSG3246385 8   -LILELLKCEPDEPQVQAKI-MAYLQQEQANR-------------------SKHEKLSTF 46
JCSG3280448 5   -LILELLKCEPDEPQVQAKI-MAYLQQEQANR-------------------SKHEKLSTF 43
JCSG302313  11  -LILELLKCEPDEPQVQAKI-MAYLQQEQSNR-------------------NRQEKLSAF 49
JCSG975436  6   -LILELLKCEPDEPQVQAKI-MAYLQQEQSNR-------------------NRQEKLSAF 44
JCSG3297975 10  -LILQLLQlEPDEdQVRARI-LGsLQEp--TK-------------------SRpDQpAAF 46
JCSG486406  6   -LILQLLQlEPDEdQVRARI-LGsLQEp--TK-------------------SRpDQpAAF 42
JCSG485253  7   -LMLQLLQlEPDEdQVRARI-LGcLQEp--TK-------------------SRpDQpAAF 43
JCSG480303  5   -LILQLLQlEPEEdQVRARI-VGcLQEpakSR-------------------S--DQpApF 41
JCSG479653  11  -LILQLLQlEPEEdQVRARI-VGcLQEpakSR-------------------S--DQpApF 47
JCSG2884071 9   -LILQLLQlEPEEdQVRARI-VGcLQEpakSR-------------------S--DQpApF 45
JCSG976373  112 ------------------------------------------------------------ 113
JCSG1476363 101 ------------------------------------------------------------ 102
JCSG478573  101 ------------------------------------------------------------ 102

QUERY       343 GLMCKMADQTLF---SI---VEWARSSIFFRELKVDDQMKLLQNCWSELLIL----DHIY 392
JCSG3228871 154 GLMCKMADQTLF---SI---VEWARSSIFFRELKVDDQMKLLQNCWSELLIL----DHIY 203
JCSG479529  57  GLMCKMADQTLF---SI---VEWARSSIFFRELKVDDQMKLLQNCWSELLIL----DHIY 106
JCSG3303764 55  GLMCKMADQTLF---SI---VEWARSSIFFRELKVDDQMKLLQNCWSELLIL----DHIY 104
JCSG3302959 51  GLMCKMADQTLF---SI---VEWARSSIFFRELKVDDQMKLLQNCWSELLIL----DHIY 100
JCSG486407  47  GLMCKMADQTLF---SI---VEWARSSIFFRELKVDDQMKLLQNCWSELLIL----DHIY 96
JCSG3199926 59  GLMCKMADQTLF---SI---VEWARSSIFFRELKVDDQMKLLQNCWSELLIL----DHIY 108
JCSG493339  58  GLMCKMADQTLF---SI---VEWARSSIFFRELKVDDQMKLLQNCWSELLIL----DHIY 107
JCSG3246385 47  GLMCKMADQTLF---SI---VEWARSSIFFRELKVDDQMKLLQNCWSELLIL----DHIY 96
JCSG3280448 44  GLMCKMADQTLF---SI---VEWARSSIFFRELKVDDQMKLLQNCWSELLIL----DHIY 93
JCSG302313  50  GLLCKMADQTLF---SI---VEWARSSIFFRELKVDDQMKLLQNCWSELLIL----DHIY 99
JCSG975436  45  GLLCKMADQTLF---SI---VEWARSSIFFRELKVDDQMKLLQNCWSELLIL----DHIY 94
JCSG3297975 47  GLLCRMADQTFI---SI---VDWARrcMvFKELEVaDQMtLLQNCWSELLVF----DHIY 96
JCSG486406  43  GLLCRMADQTFI---SI---VDWARrcMvFKELEVaDQMtLLQNCWSELLVF----DHIY 92
JCSG485253  44  GLLCRMADQTFI---SI---VDWARrcMvFKELEVaDQMtLLQNCWSELLVF----DHIY 93
JCSG480303  42  SLLCRMADQTFI---SI---VDWARrcMvFKELEVaDQMtLLQNCWSELLVL----DHIY 91
JCSG479653  48  SLLCRMADQTFI---SI---VDWARrcMvFKELEVaDQMtLLQNsWSELLVL----DHIY 97
JCSG2884071 46  SLLCRMADQTFI---SI---VDWARrcMvFKELEVaDQMtLLQNsWSELLVL----DHIY 95
JCSG976373  112 ------------------------------------------------------------ 113
JCSG1476363 101 ------------------------------------------------------------ 102
JCSG478573  101 ------------------------------------------------------------ 102

QUERY       393 -------------------RQV-VH-------------GKEGS----------IF----- 404
JCSG3228871 204 -------------------RQV-VH-------------GKEGS----------IF----- 215
JCSG479529  107 -------------------RQV-VH-------------GKEGS----------IF----- 118
JCSG3303764 105 -------------------RQV-VH-------------GKEGS----------IF----- 116
JCSG3302959 101 -------------------RQV-VH-------------GKEGS----------IF----- 112
JCSG486407  97  -------------------RQV-VH-------------GKEGS----------IF----- 108
JCSG3199926 109 -------------------RQV-VH-------------GKEGS----------IF----- 120
JCSG493339  108 -------------------RQV-VH-------------GKEGS----------IF----- 119
JCSG3246385 97  -------------------RQV-VH-------------GKEGS----------IF----- 108
JCSG3280448 94  -------------------RQV-VH-------------GKEGS----------IF----- 105
JCSG302313  100 -------------------RQV-AH-------------GKEGT----------IF----- 111
JCSG975436  95  -------------------RQV-AH-------------GKEGT----------IF----- 106
JCSG3297975 97  -------------------RQV-qH-------------GKEGS----------IL----- 108
JCSG486406  93  -------------------RQV-qH-------------GKEGS----------IL----- 104
JCSG485253  94  -------------------RQV-qH-------------GKEGS----------IL----- 105
JCSG480303  92  -------------------RQV-qY-------------GKEdS----------IL----- 103
JCSG479653  98  -------------------RQV-qY-------------GKEdS----------IL----- 109
JCSG2884071 96  -------------------RQV-qY-------------GKEdS----------IL----- 107
JCSG976373  112 ------------------------------------------------------------ 113
JCSG1476363 101 ------------------------------------------------------------ 102
JCSG478573  101 ------------------------------------------------------------ 102

QUERY       405 -----LVTGQQV-D-Y---S---I------I-ASQ--A-G--A---------T-LNNL-- 427
JCSG3228871 216 -----LVTGQQV-D-Y---S---I------I-ASQ--A-G--A---------T-LNNL-- 238
JCSG479529  119 -----LVTGQQV-D-Y---S---I------I-ASQ--A-G--A---------T-LNNL-- 141
JCSG3303764 117 -----LVTGQQV-D-Y---S---I------I-ASQ--A-G--A---------T-LNNL-- 139
JCSG3302959 113 -----LVTGQQV-D-Y---S---I------I-ASQ--A-G--A---------T-LNNL-- 135
JCSG486407  109 -----LVTGQQV-D-Y---S---I------I-ASQ--A-G--A---------T-LNNL-- 131
JCSG3199926 121 -----LVTGQQV-D-Y---S---I------I-ASQ--A-G--A---------T-LNNL-- 143
JCSG493339  120 -----LVTGQQV-D-Y---S---I------I-ASQ--A-G--A---------T-LNNL-- 142
JCSG3246385 109 -----LVTGQQV-D-Y---S---I------I-ASQ--A-G--A---------T-LNNL-- 131
JCSG3280448 106 -----LVTGQQV-D-Y---S---I------I-ASH--T-e--V---------A-FNNL-- 128
JCSG302313  112 -----LVTGEHV-D-Y---S---t------I-iSH--T-e--V---------A-FNNL-- 134
JCSG975436  107 -----LVTGEHV-D-Y---S---t------I-iSH--T-e--V---------A-FNNL-- 129
JCSG3297975 109 -----LVTGQEV-E-l---T---t------V-ATQ--A-G--S---------l-LHSL-- 131
JCSG486406  105 -----LVTGQEV-E-l---T---t------V-ATQ--A-G--S---------l-LHSL-- 127
JCSG485253  106 -----LVTGQEV-E-l---T---t------V-ATQ--A-G--S---------l-LHSL-- 128
JCSG480303  104 -----LVTGQEV-E-l---S---t------V-AvQ--A-G--S---------l-LHSL-- 126
JCSG479653  110 -----LVTGQEV-E-l---S---t------V-AvQ--A-G--S---------l-LHSL-- 132
JCSG2884071 108 -----LVTGQEV-E-l---S---t------V-AvQ--A-G--S---------l-LHSL-- 130
JCSG976373  112 ------------------------------------------------------------ 113
JCSG1476363 101 ------------------------------------------------------------ 102
JCSG478573  101 ------------------------------------------------------------ 102

QUERY       428 MSH------A---QELV----A---KLRSLQFDQREFVCLKFLVL--------F------ 457
JCSG3228871 239 MSH------A---QELV----A---KLRSLQFDQREFVCLKFLVL--------F------ 268
JCSG479529  142 MSH------A---QELV----A---KLRSLQFDQREFVCLKFLVL--------F------ 171
JCSG3303764 140 MSH------A---QELV----A---KLRSLQFDQREFVCLKFLVL--------F------ 169
JCSG3302959 136 MSH------A---QELV----A---KLRSLQFDQREFVCLKFLVL--------F------ 165
JCSG486407  132 MSH------A---QELV----A---KLRSLQFDQREFVCLKFLVL--------F------ 161
JCSG3199926 144 MSH------A---QELV----A---KLRSLQFDQREFVCLKFLVL--------F------ 173
JCSG493339  143 MSH------A---QELV----A---KLRSLQFDQREFVCLKFLVL--------F------ 172
JCSG3246385 132 MSH------A---QELV----A---KLRSLQFDQREFVCLKFLVL--------F------ 161
JCSG3280448 129 MSH------A---QELV----A---KLRSLQFDQREFVCLKFLVL--------F------ 158
JCSG302313  135 LSl------A---QELV----V---RLRSLQFDQREFVCLKFLVL--------F------ 164
JCSG975436  130 LSl------A---QELV----V---RLRSLQFDQREFVCLKFLVL--------F------ 159
JCSG3297975 132 VlR------A---QELV----l---QLlALQLDRQEFVCLKFIIL--------F------ 161
JCSG486406  128 VlR------A---QELV----l---QLlALQLDRQEFVCLKFIIL--------F------ 157
JCSG485253  129 VlR------A---QELV----l---QLlALQLDRQEFVCLKFIIL--------F------ 158
JCSG480303  127 VlR------A---QELV----l---QLHALQLDRQEFVCLKFLIL--------F------ 156
JCSG479653  133 VlR------A---QELV----l---QLHALQLDRQEFVCLKFLIL--------F------ 162
JCSG2884071 131 VlR------A---QELV----l---QLHALQLDRQEFVCLKFLIL--------F------ 160
JCSG976373  112 ------------------------------------------------------------ 113
JCSG1476363 101 ------------------------------------------------------------ 102
JCSG478573  101 ------------------------------------------------------------ 102

QUERY       458 ----S-L-------DVKNLENF-QLVEGVQEQ--------VNAA------LLDY--T--M 486
JCSG3228871 269 ----S-L-------DVKNLENF-QLVEGVQEQ--------VNAA------LLDY--T--M 297
JCSG479529  172 ----S-L-------DVKNLENF-QLVEGVQEQ--------VNAA------LLDY--T--M 200
JCSG3303764 170 ----S-L-------DVKNLENF-QLVEGVQEQ--------VNAA------LLDY--T--M 198
JCSG3302959 166 ----S-L-------DVKNLENF-QLVEGVQEQ--------VNAA------LLDY--T--M 194
JCSG486407  162 ----S-L-------DVKNLENF-QLVEGVQEQ--------VNAA------LLDY--T--M 190
JCSG3199926 174 ----S-L-------DVKNLENF-QLVEGVQEQ--------VNAA------LLDY--T--M 202
JCSG493339  173 ----S-L-------DVKNLENF-QLVEGVQEQ--------VNAA------LLDY--T--M 201
JCSG3246385 162 ----S-L-------DVKNLENF-QLVEGVQEQ--------VNAA------LLDY--T--M 190
JCSG3280448 159 ----S-L-------DVKNLENF-QLVEGVQEQ--------VNAA------LLDY--T--M 187
JCSG302313  165 ----S-s-------DVKNLENL-QLVEGVQEQ--------VNAA------LLDY--T--V 193
JCSG975436  160 ----S-s-------DVKNLENL-QLVEGVQEQ--------VNAA------LLDY--T--V 188
JCSG3297975 162 ----S-L-------DLKfLNNh-iLVKdAQEK--------ANAA------LLDY--T--L 190
JCSG486406  158 ----S-L-------DLKfLNNh-iLVKdAQEK--------ANAA------LLDY--T--L 186
JCSG485253  159 ----S-L-------DLKfLNNh-iLVKdAQEK--------ANAA------LLDY--T--L 187
JCSG480303  157 ----S-L-------DVKfLNNh-SLVKdAQEK--------ANAA------LLDY--T--L 185
JCSG479653  163 ----S-L-------DVKfLNNh-SLVKdAQEK--------ANAA------LLDY--T--L 191
JCSG2884071 161 ----S-L-------DVKfLNNh-SLVKdAQEK--------ANAA------LLDY--T--L 189
JCSG976373  112 ------------------------------------------------------------ 113
JCSG1476363 101 ------------------------------------------------------------ 102
JCSG478573  101 ------------------------------------------------------------ 102

QUERY       487 ---------------CNY----PQ--QT---EK--FGQLLLRLPE-IRAI-SMQAEEYL- 517
JCSG3228871 298 ---------------CNY----PQ--QT---EK--FGQLLLRLPE-IRAI-SMQAEEYL- 328
JCSG479529  201 ---------------CNY----PQ--QT---EK--FGQLLLRLPE-IRAI-SMQAEEYL- 231
JCSG3303764 199 ---------------CNY----PQ--QT---EK--FGQLLLRLPE-IRAI-SMQAEEYL- 229
JCSG3302959 195 ---------------CNY----PQ--QT---EK--FGQLLLRLPE-IRAI-SMQAEEYL- 225
JCSG486407  191 ---------------CNY----PQ--QT---EK--FGQLLLRLPE-IRAI-SMQAEEYL- 221
JCSG3199926 203 ---------------CNY----PQ--QT---EK--FGQLLLRLPE-IRAI-SMQAEEYL- 233
JCSG493339  202 ---------------CNY----PQ--QT---EK--FGQLLLRLPE-IRAI-SMQAEEYL- 232
JCSG3246385 191 ---------------CNY----PQ--QT---EK--FGQLLLRLPE-IRAI-SMQAEEYL- 221
JCSG3280448 188 ---------------CNY----PQ--QT---EK--FGQLLLRLPE-IRAI-SMQAEEYL- 218
JCSG302313  194 ---------------CNY----PQ--QT---EK--FGQLLLRLPE-LRAI-SkQAEDYL- 224
JCSG975436  189 ---------------CNY----PQ--QT---EK--FGQLLLRLPE-IRAI-SkQAEDYL- 219
JCSG3297975 191 ---------------CHY----PH--Sg---DK--FqQLLLcLvE-VRAL-SMQAKEYL- 221
JCSG486406  187 ---------------CHY----PH--Sg---DK--FqQLLLcLvE-VRAL-SMQAKEYL- 217
JCSG485253  188 ---------------CHY----PH--cg---DK--FqQLLLcLvE-VRAL-SMQAKEYL- 218
JCSG480303  186 ---------------CHY----PH--cg---DK--FqQLLLcLvE-VRAL-SMQAKEYL- 216
JCSG479653  192 ---------------sHY----PH--Sg---DK--FqQLLLsLvE-VRAL-SMQAKEYL- 222
JCSG2884071 190 ---------------sHY----PH--Sg---DK--FqQLLLsLvE-VRAL-SMQAKEYL- 220
JCSG976373  112 ------------------------------------------------------------ 113
JCSG1476363 101 ------------------------------------------------------------ 102
JCSG478573  101 ------------------------------------------------------------ 102

QUERY       518 YYKHLNG---DVPYNNLLIEMLHAKRA 541
JCSG3228871 329 YYKHLNG---DVPYNNLLIEMLHAKRA 352
JCSG479529  232 YYKHLNG---DVPYNNLLIEMLHAKRA 255
JCSG3303764 230 YYKHLNG---DVPYNNLLIEMLHAKRA 253
JCSG3302959 226 YYKHLNG---DVPYNNLLIEMLHAKRA 249
JCSG486407  222 YYKHLNG---DVPYNNLLIEMLHAKRA 245
JCSG3199926 234 YYKHLNG---DVPYNNLLIEMLHAKRA 257
JCSG493339  233 YYKHLNG---DVPYNNLLIEMLHAKRA 256
JCSG3246385 222 YYKHLNG---DVPYNNLLIEMLHA--- 242
JCSG3280448 219 YYKHLNG---DVPYNNLLIEMLHA--- 239
JCSG302313  225 YYKHVNG---DVPYNNLLIEMLHAKRA 248
JCSG975436  220 YYKHVNG---DVPYNNLLIEMLHAKRA 243
JCSG3297975 222 YHKHLGN---EMPrNNLLIEMLQAKQ- 244
JCSG486406  218 YHKHLGN---EMPrNNLLIEMLQAKQ- 240
JCSG485253  219 YHKHLGN---EMPrNNLLIEMLQAKQ- 241
JCSG480303  217 YHKHLGN---EMPrNNLLIEMLQAKQ- 239
JCSG479653  223 YHKHLGN---EMPrNNLLIEMLQAKQ- 245
JCSG2884071 221 YHKHLGN---EMPrNNLLIEMLQAKQ- 243
JCSG976373  112 --------------------------- 113
JCSG1476363 101 --------------------------- 102
JCSG478573  101 --------------------------- 102

Note
Homologous search is done using BLAST from NCBI BLAST against database pdbnr with expect (E-value cut-off) at 0.001. The structure of a PDB sequence may be fully or partly solved. The non-redundant database pdbnr consists of unique PDB sequences from the representative PDB chains. Each representative chain has the best structural coverage in the set of the same sequences. You could click a sequence ID to see all of PDB chains associated with the sequence ID plus sequence alignments and structural coverages.



Contact Webmaster JCSG Menu