LOADING...
   13422365;PC07372D
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
13422365    PDB Fold Similairty





PDB sequences with significant alignments
Sequence information                                           Score	E-value
JCSG3255264|pdb|4GOQ_A|hypothetical protein                       219	5e-58
JCSG3087078|pdb|2KNR_A|Uncharacterized protein ATC0905            55	1e-08
PDB sequence alignments
QUERY       1   MLLSTDIWVAALIRRAELGGAFATVARKGDARAGAVLVKAVDRREGTARLFSEATRGDGE 60
JCSG3255264 2   MLLSTDIWVAALIRRAELGGAFATVARKGDARAGAVLVKAVDRREGTARLFSEATRGDGE 61
JCSG3087078 4   MrLKSEMFVSALIRRVfaAGGFAAVeKKGaeaAGAIFVRq-rlRDGreNLYGpApQSfAD 62

QUERY       61  RFWMQPVRSTFE--------PDLDAYAERAARIDPDIWVVEIEDRDGRHFLTEPVES 109
JCSG3255264 62  RFWMQPVRSTFE--------PDLDAYAERAARIDPDIWVVEIEDRDGRHFLTEPVES 110
JCSG3087078 63  dedIMrAErrFEtrlagvegeEIaAllERerRFDsDLWVVEIE-------------- 105

Note
Homologous search is done using BLAST from NCBI BLAST against database pdbnr with expect (E-value cut-off) at 0.001. The structure of a PDB sequence may be fully or partly solved. The non-redundant database pdbnr consists of unique PDB sequences from the representative PDB chains. Each representative chain has the best structural coverage in the set of the same sequences. You could click a sequence ID to see all of PDB chains associated with the sequence ID plus sequence alignments and structural coverages.



Contact Webmaster JCSG Menu