LOADING...
   104161995;ME9797A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
104161995    PDB Fold Similairty





PDB sequences with significant alignments
Sequence information                                           Score	E-value
JCSG1563093|pdb|2PQ7_A|Predicted HD superfamily hydrolase         436	e-123
JCSG2877810|pdb|3DTO_A|BH2835 protein                             103	7e-23
JCSG1580035|pdb|2QGS_A|Protein SE1688                             102	1e-22
JCSG2876715|pdb|3DJB_A|Hydrolase, HD family                       99	2e-21
JCSG2988818|pdb|3GW7_A|Uncharacterized protein yedJ               92	2e-19
JCSG1559323|pdb|2PJQ_C|Uncharacterized protein lp_2664            88	5e-18
JCSG1662165|pdb|3B57_A|Lin1889 protein                            78	5e-15
PDB sequence alignments
QUERY       1   MNLTELMERIPHLREILNIVREAFKDYDDPAHDISHTFRVMENASEIASREKC-DLQKAI 59
JCSG1563093 2   MNLTELMERIPHLREILNIVREAFKDYDDPAHDISHTFRVMENASEIASREKC-DLQKAI 60
JCSG2877810 25  -------------------------------HDwyHirRVtlmAKaIGEQEKv-DVfvVq 52
JCSG1580035 15  ---------------------KSFhQHDttGHDIAHVeRVyNNAcyIAKRENitDtlvie 53
JCSG2876715 21  ---------------------------DasGHDwyHirRVhKmAiSLSEQEgg-Nrfiie 52
JCSG2988818 20  --------------------------HQDaAHDVcHfrRVwaTAQKLAAdDdv-DMlviL 52
JCSG1559323 25  --------------------------HDhsGHgrDHlqRVnRlArRLAKdEgA-NLNlTL 57
JCSG1662165 25  -------------------------------HDwSHikRVwKlSKEIqSKEgg-DLftie 52

QUERY       60  IAALLHDI---------KRPHEALTGVDHAESGAEYASGLLPTMGFDISFVAEVSKAIRS 110
JCSG1563093 61  IAALLHDI---------KRPHEALTGVDHAESGAEYASGLLPTMGFDISFVAEVSKAIRS 111
JCSG2877810 53  IAALFHDL---------iddkl----VDdpETAkQqlidwMeAaGvpsQkIdHTmdiINT 99
JCSG1580035 54  LSSLLHDtvd-------SKltDeIlAyDQlKQ-------FLsTLdLSsEIsqQVlyiIKh 99
JCSG2876715 53  MAALLHDV---------a--dEkLN--EseEAGmKkVSdwLeeLhvEeEeskHVlhiIaN 99
JCSG2988818 53  tACyFHDIvslak----NHPQRqrSSIlaAEEtrRllreeFeq--FpaEkIeaVchAIaA 106
JCSG1559323 58  aAAwLHDViddklmanpaKaHQdLi----VQlNAQnVTAddqTaiFaIidhmSfSKSFN- 112
JCSG1662165 53  LAALFHD-------------YSdIklTtdeQEATKtliNwMeTkeIpsELIkKIiRiIQS 99

QUERY       111 HRYSGG---L--T---PTSLTGK--ILQDADRLDAIGAVAIARVFSYSGKTGTPLH---- 156
JCSG1563093 112 HRYSGG---L--T---PTSLTGK--ILQDADRLDAIGAVAIARVFSYSGKTGTPLH---- 157
JCSG2877810 100 isFKGG---h--g---qSlaTrEamVVQDADRLDALGAIGIARTFAYSGNkGqPIY---- 147
JCSG1580035 100 msYrAG---k--NnhvklSIdGE--IVRDADRLDAIGAIGIARTFQFSGhfGePMwtetk 152
JCSG2876715 100 msYKGG---hggk---veSIeGK--LVQDADRLDALGAIGIARTFAYGGakGrlMY---- 147
JCSG2988818 107 HsFSAq---I--A---PlTteAK--IVQDADRLEALGAIGLARVFAvSGalGVaLf---- 152
JCSG1559323 113 -----G---p--q---klSLeGQ--VVQDADRLDAIGAIGIARALyYSGhVGekIY---- 153
JCSG1662165 100 vsFKkGkntF--k---alTIeeK--IVQDADRLDAIGAIGIARTFTYGGahNreIa---- 148

QUERY       157 -SLQFSP-----R-----SS-----YS--GNSRSSINHFHEKILKIRPETFWTETARKMA 198
JCSG1563093 158 -SLQFSP-----R-----SS-----YS--GNSRSSINHFHEKILKIRPETFWTETARKMA 199
JCSG2877810 148 -DpELpi-----R-----ETmtveeYr--hGKsTAINHFYEKLFKLK-DlMnTETGKQLA 193
JCSG1580035 153 lSnEelh-----t-----Sl-----vE--elDNSAIKHFYEKLFKLK-DlMhTpTAKKLA 194
JCSG2876715 148 -DptIpP-----RevmtkDE-----Yr--kNNdpSLNHFYEKLLKLK-DlMnTNAAKQeA 193
JCSG2988818 153 -DgE-DP-----f-----AQ-----HrpldDKRyALDHFQtKLLKL-PQTMqTarGKQLA 194
JCSG1559323 154 -DpaIAPrehmtR-----EQ-----Yr--hQpgTAINHFYEKLFKL-aalMnTDTAKaLA 199
JCSG1662165 149 -N-QnNP-----K-----N--------------TTLQHFYDKLLlIK-DqLnTETAKtIA 181

QUERY       199 EDRYSFVVEFVQRFLAEWGQI 219
JCSG1563093 200 EDRYSFVVEFVQRFLAEWGQI 220
JCSG2877810 194 KERHvFMeQFIERFLSEW--- 211
JCSG1580035 195 EERHQFMIQYLKQFMSEW--- 212
JCSG2876715 194 EvRHrYMeQFIEQFMkEW--- 211
JCSG2988818 195 QhNahFLVEFMaKLsAE---- 211
JCSG1559323 200 ahRtAvMhEFVDQFkAEW--- 217
JCSG1662165 182 KEKqKIMqDFIQ--------- 193

Note
Homologous search is done using BLAST from NCBI BLAST against database pdbnr with expect (E-value cut-off) at 0.001. The structure of a PDB sequence may be fully or partly solved. The non-redundant database pdbnr consists of unique PDB sequences from the representative PDB chains. Each representative chain has the best structural coverage in the set of the same sequences. You could click a sequence ID to see all of PDB chains associated with the sequence ID plus sequence alignments and structural coverages.



Contact Webmaster JCSG Menu