LOADING...
   ZP_02030716.1;SP16962B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02030716.1    Chemical properties of target construct

Accession: ZP_02030716.1
Description: gi|154490775|ref|ZP_02030716.1| hypothetical protein PARMER_00689 [Parabacteroides merdae ATCC 43184]
Organism: Parabacteroides merdae
Residues: 256 aa
Local acc: SP16962B
Target id: 419167
Alias:
Construct: Fragment: 29-256

  Full Fragment Fragment with tag Fragment with modification Fragment with tag and modification
Residues(aa) 256 228 240 228 240
Molecular Weight (Dalton) 29043.79 25997.29 27451.84 25997.29 27451.84
Isoelectric Point 8.69 7.09 7.14 7.09 7.14
Extinction Coefficient 40910 40910 40910 40910 40910
Gravy -0.38 -0.42 -0.49 -0.42 -0.49
Number of Met 7 5 6 5 6
%Met 2.73 2.19 2.50 2.19 2.50
Number of Cys 5 5 5 5 5
%Cys >1.95 2.19 2.08 2.19 2.08
SEQUENCE  amino acids 240 aa; construct sequence with modification and tag mgsdkihhhhhh
>SP16962B|29-256 gi|154490775|ref|ZP_02030716.1| hypothetical protein PARMER_00689 [Parabacteroides merdae ATCC 43184]
mgsdkihhhhhhAVKENTSVHAPKINLKKDCVILFQGDSITDCGRDRNSNRCNTMEQFGS
GYVLFTATQLLEGKAALQPKIYNRGISGNKVYQLRERWEIDCLAFQPDVLSILIGVNDYW
HTLTHGYKGTVETYENDLRALLKYTKEKLPNTQIVLCEPFTLRDGAAIEDSKWYPMFDEF
RKSARKLSEEFNTIFVPFQSGFDAAVKLAPARYWSNDGVHPDLPGRQLMANMWMEATGLK

SEQUENCE  amino acids 228 aa; construct sequence without modification or tag
>SP16962B|29-256 gi|154490775|ref|ZP_02030716.1| hypothetical protein PARMER_00689 [Parabacteroides merdae ATCC 43184]
AVKENTSVHAPKINLKKDCVILFQGDSITDCGRDRNSNRCNTMEQFGSGYVLFTATQLLE
GKAALQPKIYNRGISGNKVYQLRERWEIDCLAFQPDVLSILIGVNDYWHTLTHGYKGTVE
TYENDLRALLKYTKEKLPNTQIVLCEPFTLRDGAAIEDSKWYPMFDEFRKSARKLSEEFN
TIFVPFQSGFDAAVKLAPARYWSNDGVHPDLPGRQLMANMWMEATGLK

SEQUENCE  amino acids 240 aa; construct sequence with tag but no modification; mgsdkihhhhhh
>SP16962B|29-256 gi|154490775|ref|ZP_02030716.1| hypothetical protein PARMER_00689 [Parabacteroides merdae ATCC 43184]
mgsdkihhhhhhAVKENTSVHAPKINLKKDCVILFQGDSITDCGRDRNSNRCNTMEQFGS
GYVLFTATQLLEGKAALQPKIYNRGISGNKVYQLRERWEIDCLAFQPDVLSILIGVNDYW
HTLTHGYKGTVETYENDLRALLKYTKEKLPNTQIVLCEPFTLRDGAAIEDSKWYPMFDEF
RKSARKLSEEFNTIFVPFQSGFDAAVKLAPARYWSNDGVHPDLPGRQLMANMWMEATGLK

SEQUENCE  amino acids 228 aa; construct sequence with modification but no tag
>SP16962B|29-256 gi|154490775|ref|ZP_02030716.1| hypothetical protein PARMER_00689 [Parabacteroides merdae ATCC 43184]
AVKENTSVHAPKINLKKDCVILFQGDSITDCGRDRNSNRCNTMEQFGSGYVLFTATQLLE
GKAALQPKIYNRGISGNKVYQLRERWEIDCLAFQPDVLSILIGVNDYWHTLTHGYKGTVE
TYENDLRALLKYTKEKLPNTQIVLCEPFTLRDGAAIEDSKWYPMFDEFRKSARKLSEEFN
TIFVPFQSGFDAAVKLAPARYWSNDGVHPDLPGRQLMANMWMEATGLK

SEQUENCE  amino acids 256 aa; full sequence in database
>SP16962B|1-256 gi|154490775|ref|ZP_02030716.1| hypothetical protein PARMER_00689 [Parabacteroides merdae ATCC 43184]
MKNSRRDFLKKGALAGFSALMIPEIAKAAVKENTSVHAPKINLKKDCVILFQGDSITDCG
RDRNSNRCNTMEQFGSGYVLFTATQLLEGKAALQPKIYNRGISGNKVYQLRERWEIDCLA
FQPDVLSILIGVNDYWHTLTHGYKGTVETYENDLRALLKYTKEKLPNTQIVLCEPFTLRD
GAAIEDSKWYPMFDEFRKSARKLSEEFNTIFVPFQSGFDAAVKLAPARYWSNDGVHPDLP
GRQLMANMWMEATGLK


Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus. Special tag in protocol 30: N-terminal HHHHHHTDPALRA, first residue deleted and C-terminal GLCGR.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu