LOADING...
   YP_098753.1;SP13297E
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_098753.1    Chemical properties of target construct

Accession: YP_098753.1
Description: gi|53712761|ref|YP_098753.1| hypothetical protein BF1468 [Bacteroides fragilis YCH46]
Organism: Bacteroides fragilis YCH46
Residues: 130 aa
Local acc: SP13297E
Target id: 418300
Alias:
Construct: Fragment: 22-130

  Full Fragment Fragment with tag Fragment with modification Fragment with tag and modification
Residues(aa) 130 109 121 109 121
Molecular Weight (Dalton) 14646.05 12282.18 13736.73 12282.18 13736.73
Isoelectric Point 9.93 9.51 9.46 9.51 9.46
Extinction Coefficient 8480 2980 2980 2980 2980
Gravy -0.19 -0.48 -0.61 -0.48 -0.61
Number of Met 2 0 1 0 1
%Met 1.54 0.00 0.83 0.00 0.83
Number of Cys 1 1 1 1 1
%Cys >0.77 0.92 0.83 0.92 0.83
SEQUENCE  amino acids 121 aa; construct sequence with modification and tag mgsdkihhhhhh
>SP13297E|22-130 gi|53712761|ref|YP_098753.1| hypothetical protein BF1468 [Bacteroides fragilis YCH46]
mgsdkihhhhhhQDIPVGVVVAFKKGNSQELNRYLGEKVNLVIQNRSESVDRQAAEGTLA
AFFSSNKVSGFNVNHEGKRDESSFIIGTLTTANGNFRINCFFRRVQNKYLINQIRIDKTN
E

SEQUENCE  amino acids 109 aa; construct sequence without modification or tag
>SP13297E|22-130 gi|53712761|ref|YP_098753.1| hypothetical protein BF1468 [Bacteroides fragilis YCH46]
QDIPVGVVVAFKKGNSQELNRYLGEKVNLVIQNRSESVDRQAAEGTLAAFFSSNKVSGFN
VNHEGKRDESSFIIGTLTTANGNFRINCFFRRVQNKYLINQIRIDKTNE

SEQUENCE  amino acids 121 aa; construct sequence with tag but no modification; mgsdkihhhhhh
>SP13297E|22-130 gi|53712761|ref|YP_098753.1| hypothetical protein BF1468 [Bacteroides fragilis YCH46]
mgsdkihhhhhhQDIPVGVVVAFKKGNSQELNRYLGEKVNLVIQNRSESVDRQAAEGTLA
AFFSSNKVSGFNVNHEGKRDESSFIIGTLTTANGNFRINCFFRRVQNKYLINQIRIDKTN
E

SEQUENCE  amino acids 109 aa; construct sequence with modification but no tag
>SP13297E|22-130 gi|53712761|ref|YP_098753.1| hypothetical protein BF1468 [Bacteroides fragilis YCH46]
QDIPVGVVVAFKKGNSQELNRYLGEKVNLVIQNRSESVDRQAAEGTLAAFFSSNKVSGFN
VNHEGKRDESSFIIGTLTTANGNFRINCFFRRVQNKYLINQIRIDKTNE

SEQUENCE  amino acids 130 aa; full sequence in database
>SP13297E|1-130 gi|53712761|ref|YP_098753.1| hypothetical protein BF1468 [Bacteroides fragilis YCH46]
MKKRVLLWMAGLVFAVTSLFAQDIPVGVVVAFKKGNSQELNRYLGEKVNLVIQNRSESVD
RQAAEGTLAAFFSSNKVSGFNVNHEGKRDESSFIIGTLTTANGNFRINCFFRRVQNKYLI
NQIRIDKTNE


Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus. Special tag in protocol 30: N-terminal HHHHHHTDPALRA, first residue deleted and C-terminal GLCGR.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu