LOADING...
   ZP_02069929.1;SP13538A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02069929.1    Chemical properties of target construct

Accession: ZP_02069929.1
Description: gi|160888926|ref|ZP_02069929.1| hypothetical protein BACUNI_01346 [Bacteroides uniformis ATCC 8492]
Organism: Bacteroides uniformis
Residues: 135 aa
Local acc: SP13538A
Target id: 417932
Alias:
Construct: Fragment: 21-135

  Full Fragment Fragment with tag Fragment with modification Fragment with tag and modification
Residues(aa) 135 115 127 115 127
Molecular Weight (Dalton) 15324.81 12994.94 14449.49 12994.94 14449.49
Isoelectric Point 7.59 5.40 6.58 5.40 6.58
Extinction Coefficient 29910 22920 22920 22920 22920
Gravy -0.12 -0.38 -0.51 -0.38 -0.51
Number of Met 3 1 2 1 2
%Met 2.22 0.87 1.57 0.87 1.57
Number of Cys 4 3 3 3 3
%Cys >2.96 2.61 2.36 2.61 2.36
SEQUENCE  amino acids 127 aa; construct sequence with modification and tag mgsdkihhhhhh
>SP13538A|21-135 gi|160888926|ref|ZP_02069929.1| hypothetical protein BACUNI_01346 [Bacteroides uniformis ATCC 8492]
mgsdkihhhhhhCMNGGGDLAGKWQLRQYQYADGTSEKVDSVFYNFQKGSFSAICLLKDG
GLTTFFGNYSLKGAEISIILLPESVNDKNYDTYFGWPEGKCTFKVEDLSYSSLRLEYEGT
KSIFRKF

SEQUENCE  amino acids 115 aa; construct sequence without modification or tag
>SP13538A|21-135 gi|160888926|ref|ZP_02069929.1| hypothetical protein BACUNI_01346 [Bacteroides uniformis ATCC 8492]
CMNGGGDLAGKWQLRQYQYADGTSEKVDSVFYNFQKGSFSAICLLKDGGLTTFFGNYSLK
GAEISIILLPESVNDKNYDTYFGWPEGKCTFKVEDLSYSSLRLEYEGTKSIFRKF

SEQUENCE  amino acids 127 aa; construct sequence with tag but no modification; mgsdkihhhhhh
>SP13538A|21-135 gi|160888926|ref|ZP_02069929.1| hypothetical protein BACUNI_01346 [Bacteroides uniformis ATCC 8492]
mgsdkihhhhhhCMNGGGDLAGKWQLRQYQYADGTSEKVDSVFYNFQKGSFSAICLLKDG
GLTTFFGNYSLKGAEISIILLPESVNDKNYDTYFGWPEGKCTFKVEDLSYSSLRLEYEGT
KSIFRKF

SEQUENCE  amino acids 115 aa; construct sequence with modification but no tag
>SP13538A|21-135 gi|160888926|ref|ZP_02069929.1| hypothetical protein BACUNI_01346 [Bacteroides uniformis ATCC 8492]
CMNGGGDLAGKWQLRQYQYADGTSEKVDSVFYNFQKGSFSAICLLKDGGLTTFFGNYSLK
GAEISIILLPESVNDKNYDTYFGWPEGKCTFKVEDLSYSSLRLEYEGTKSIFRKF

SEQUENCE  amino acids 135 aa; full sequence in database
>SP13538A|1-135 gi|160888926|ref|ZP_02069929.1| hypothetical protein BACUNI_01346 [Bacteroides uniformis ATCC 8492]
MMKLHLKYLWIVLVACTLTACMNGGGDLAGKWQLRQYQYADGTSEKVDSVFYNFQKGSFS
AICLLKDGGLTTFFGNYSLKGAEISIILLPESVNDKNYDTYFGWPEGKCTFKVEDLSYSS
LRLEYEGTKSIFRKF


Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus. Special tag in protocol 30: N-terminal HHHHHHTDPALRA, first residue deleted and C-terminal GLCGR.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu