LOADING...
   ZP_02066560.1;SP8524C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02066560.1    Chemical properties of target construct

Accession: ZP_02066560.1
Description: gi|160885557|ref|ZP_02066560.1| hypothetical protein BACOVA_03559 [Bacteroides ovatus ATCC 8483]
Organism: Bacteroides ovatus
Residues: 380 aa
Local acc: SP8524C
Target id: 416724
Alias:
Construct: Fragment: 27-380

  Full Fragment Fragment with tag Fragment with modification Fragment with tag and modification
Residues(aa) 380 354 366 354 366
Molecular Weight (Dalton) 41953.11 39016.67 40471.22 39016.67 40471.22
Isoelectric Point 4.96 4.89 5.30 4.89 5.30
Extinction Coefficient 61770 58790 58790 58790 58790
Gravy -0.18 -0.25 -0.30 -0.25 -0.30
Number of Met 14 9 10 9 10
%Met 3.68 2.54 2.73 2.54 2.73
Number of Cys 1 0 0 0 0
%Cys >0.26 0.00 0.00 0.00 0.00
SEQUENCE  amino acids 366 aa; construct sequence with modification and tag mgsdkihhhhhh
>SP8524C|27-380 gi|160885557|ref|ZP_02066560.1| hypothetical protein BACOVA_03559 [Bacteroides ovatus ATCC 8483]
mgsdkihhhhhhNDLLEPKVYFESKEYNFSVEDEMDVMTFDLVSRLSSATSSQVDVSYSV
AEPSVVDEYNAKYGTNYEMLDVSQVKLSSTTSSISSGKLYADNIEVELSGLEALKAGNSY
VLPMRVHSSSVSTLSGTNIAYFFFSKPLKITKAGNFSNHYISVKFPVGTFFSSFTYEALI
NVDYFLDNNTIMGTEGVMILRIGDAGGGITPKDYLEVAGGQNYRVTKPLLTNRWYHVALT
YDQPTGKTGIYVNGEKWAGSDWGIDGFDPNSDMGFYIGRIYGFKWGERPFHGKMSEVRVW
SVARTENQLKQNMLGVDPASEGLALYYKLDGSETQEGGVIKDATGRINGTTNGITIKTLD
APIAIN

SEQUENCE  amino acids 354 aa; construct sequence without modification or tag
>SP8524C|27-380 gi|160885557|ref|ZP_02066560.1| hypothetical protein BACOVA_03559 [Bacteroides ovatus ATCC 8483]
NDLLEPKVYFESKEYNFSVEDEMDVMTFDLVSRLSSATSSQVDVSYSVAEPSVVDEYNAK
YGTNYEMLDVSQVKLSSTTSSISSGKLYADNIEVELSGLEALKAGNSYVLPMRVHSSSVS
TLSGTNIAYFFFSKPLKITKAGNFSNHYISVKFPVGTFFSSFTYEALINVDYFLDNNTIM
GTEGVMILRIGDAGGGITPKDYLEVAGGQNYRVTKPLLTNRWYHVALTYDQPTGKTGIYV
NGEKWAGSDWGIDGFDPNSDMGFYIGRIYGFKWGERPFHGKMSEVRVWSVARTENQLKQN
MLGVDPASEGLALYYKLDGSETQEGGVIKDATGRINGTTNGITIKTLDAPIAIN

SEQUENCE  amino acids 366 aa; construct sequence with tag but no modification; mgsdkihhhhhh
>SP8524C|27-380 gi|160885557|ref|ZP_02066560.1| hypothetical protein BACOVA_03559 [Bacteroides ovatus ATCC 8483]
mgsdkihhhhhhNDLLEPKVYFESKEYNFSVEDEMDVMTFDLVSRLSSATSSQVDVSYSV
AEPSVVDEYNAKYGTNYEMLDVSQVKLSSTTSSISSGKLYADNIEVELSGLEALKAGNSY
VLPMRVHSSSVSTLSGTNIAYFFFSKPLKITKAGNFSNHYISVKFPVGTFFSSFTYEALI
NVDYFLDNNTIMGTEGVMILRIGDAGGGITPKDYLEVAGGQNYRVTKPLLTNRWYHVALT
YDQPTGKTGIYVNGEKWAGSDWGIDGFDPNSDMGFYIGRIYGFKWGERPFHGKMSEVRVW
SVARTENQLKQNMLGVDPASEGLALYYKLDGSETQEGGVIKDATGRINGTTNGITIKTLD
APIAIN

SEQUENCE  amino acids 354 aa; construct sequence with modification but no tag
>SP8524C|27-380 gi|160885557|ref|ZP_02066560.1| hypothetical protein BACOVA_03559 [Bacteroides ovatus ATCC 8483]
NDLLEPKVYFESKEYNFSVEDEMDVMTFDLVSRLSSATSSQVDVSYSVAEPSVVDEYNAK
YGTNYEMLDVSQVKLSSTTSSISSGKLYADNIEVELSGLEALKAGNSYVLPMRVHSSSVS
TLSGTNIAYFFFSKPLKITKAGNFSNHYISVKFPVGTFFSSFTYEALINVDYFLDNNTIM
GTEGVMILRIGDAGGGITPKDYLEVAGGQNYRVTKPLLTNRWYHVALTYDQPTGKTGIYV
NGEKWAGSDWGIDGFDPNSDMGFYIGRIYGFKWGERPFHGKMSEVRVWSVARTENQLKQN
MLGVDPASEGLALYYKLDGSETQEGGVIKDATGRINGTTNGITIKTLDAPIAIN

SEQUENCE  amino acids 380 aa; full sequence in database
>SP8524C|1-380 gi|160885557|ref|ZP_02066560.1| hypothetical protein BACOVA_03559 [Bacteroides ovatus ATCC 8483]
MMNKHIFYYLMVGSMALLLGACNDSMNDLLEPKVYFESKEYNFSVEDEMDVMTFDLVSRL
SSATSSQVDVSYSVAEPSVVDEYNAKYGTNYEMLDVSQVKLSSTTSSISSGKLYADNIEV
ELSGLEALKAGNSYVLPMRVHSSSVSTLSGTNIAYFFFSKPLKITKAGNFSNHYISVKFP
VGTFFSSFTYEALINVDYFLDNNTIMGTEGVMILRIGDAGGGITPKDYLEVAGGQNYRVT
KPLLTNRWYHVALTYDQPTGKTGIYVNGEKWAGSDWGIDGFDPNSDMGFYIGRIYGFKWG
ERPFHGKMSEVRVWSVARTENQLKQNMLGVDPASEGLALYYKLDGSETQEGGVIKDATGR
INGTTNGITIKTLDAPIAIN


Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus. Special tag in protocol 30: N-terminal HHHHHHTDPALRA, first residue deleted and C-terminal GLCGR.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu