LOADING...
   NP_251743.1;SP16046A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_251743.1    Chemical properties of target construct

Accession: NP_251743.1
Description: gi|15598249|ref|NP_251743.1| probable hydrolytic enzyme [Pseudomonas aeruginosa PA01]
Organism: PSEUDOMONAS AERUGINOSA
Residues: 335 aa
Local acc: SP16046A
Target id: 413214
Alias:
Construct: Full: 1-335

  Full Fragment Fragment with tag Fragment with modification Fragment with tag and modification
Residues(aa) 335 335 347 335 347
Molecular Weight (Dalton) 37482.90 37482.90 38937.45 37482.90 38937.45
Isoelectric Point 7.68 7.68 7.75 7.68 7.75
Extinction Coefficient 65320 65320 65320 65320 65320
Gravy -0.23 -0.23 -0.29 -0.23 -0.29
Number of Met 9 9 10 9 10
%Met 2.69 2.69 2.88 2.69 2.88
Number of Cys 4 4 4 4 4
%Cys >1.19 1.19 1.15 1.19 1.15
SEQUENCE  amino acids 347 aa; construct sequence with modification and tag mgsdkihhhhhh
>SP16046A|1-335 gi|15598249|ref|NP_251743.1| probable hydrolytic enzyme [Pseudomonas aeruginosa PA01]
mgsdkihhhhhhMSLPRLSLSLCLALACGPALASQAPVYGERLEGFDYAYPVHYLDFTSQ
GQPLSMAYLDVAPKKANGRTILLMHGKNFCAGTWERTIDVLADAGYRVIAVDQVGFCKSS
KPAHYQYSFQQLAANTHALLERLGVARASVIGHSMGGMLATRYALLYPRQVERLVLVNPI
GLEDWKALGVPWRSVDDWYRRDLQTSAEGIRQYQQATYYAGEWRPEFDRWVQMQAGMYRG
KGRESVAWNSALTYDMIFTQPVVYELDRLQMPTLLLIGEKDNTAIGKDAAPAELKARLGN
YAQLGKDAARRIPQATLVEFPDLGHTPQIQAPERFHQALLEGLQTQP

SEQUENCE  amino acids 335 aa; construct sequence without modification or tag
>SP16046A|1-335 gi|15598249|ref|NP_251743.1| probable hydrolytic enzyme [Pseudomonas aeruginosa PA01]
MSLPRLSLSLCLALACGPALASQAPVYGERLEGFDYAYPVHYLDFTSQGQPLSMAYLDVA
PKKANGRTILLMHGKNFCAGTWERTIDVLADAGYRVIAVDQVGFCKSSKPAHYQYSFQQL
AANTHALLERLGVARASVIGHSMGGMLATRYALLYPRQVERLVLVNPIGLEDWKALGVPW
RSVDDWYRRDLQTSAEGIRQYQQATYYAGEWRPEFDRWVQMQAGMYRGKGRESVAWNSAL
TYDMIFTQPVVYELDRLQMPTLLLIGEKDNTAIGKDAAPAELKARLGNYAQLGKDAARRI
PQATLVEFPDLGHTPQIQAPERFHQALLEGLQTQP

SEQUENCE  amino acids 347 aa; construct sequence with tag but no modification; mgsdkihhhhhh
>SP16046A|1-335 gi|15598249|ref|NP_251743.1| probable hydrolytic enzyme [Pseudomonas aeruginosa PA01]
mgsdkihhhhhhMSLPRLSLSLCLALACGPALASQAPVYGERLEGFDYAYPVHYLDFTSQ
GQPLSMAYLDVAPKKANGRTILLMHGKNFCAGTWERTIDVLADAGYRVIAVDQVGFCKSS
KPAHYQYSFQQLAANTHALLERLGVARASVIGHSMGGMLATRYALLYPRQVERLVLVNPI
GLEDWKALGVPWRSVDDWYRRDLQTSAEGIRQYQQATYYAGEWRPEFDRWVQMQAGMYRG
KGRESVAWNSALTYDMIFTQPVVYELDRLQMPTLLLIGEKDNTAIGKDAAPAELKARLGN
YAQLGKDAARRIPQATLVEFPDLGHTPQIQAPERFHQALLEGLQTQP

SEQUENCE  amino acids 335 aa; construct sequence with modification but no tag
>SP16046A|1-335 gi|15598249|ref|NP_251743.1| probable hydrolytic enzyme [Pseudomonas aeruginosa PA01]
MSLPRLSLSLCLALACGPALASQAPVYGERLEGFDYAYPVHYLDFTSQGQPLSMAYLDVA
PKKANGRTILLMHGKNFCAGTWERTIDVLADAGYRVIAVDQVGFCKSSKPAHYQYSFQQL
AANTHALLERLGVARASVIGHSMGGMLATRYALLYPRQVERLVLVNPIGLEDWKALGVPW
RSVDDWYRRDLQTSAEGIRQYQQATYYAGEWRPEFDRWVQMQAGMYRGKGRESVAWNSAL
TYDMIFTQPVVYELDRLQMPTLLLIGEKDNTAIGKDAAPAELKARLGNYAQLGKDAARRI
PQATLVEFPDLGHTPQIQAPERFHQALLEGLQTQP

SEQUENCE  amino acids 335 aa; full sequence in database
>SP16046A|1-335 gi|15598249|ref|NP_251743.1| probable hydrolytic enzyme [Pseudomonas aeruginosa PA01]
MSLPRLSLSLCLALACGPALASQAPVYGERLEGFDYAYPVHYLDFTSQGQPLSMAYLDVA
PKKANGRTILLMHGKNFCAGTWERTIDVLADAGYRVIAVDQVGFCKSSKPAHYQYSFQQL
AANTHALLERLGVARASVIGHSMGGMLATRYALLYPRQVERLVLVNPIGLEDWKALGVPW
RSVDDWYRRDLQTSAEGIRQYQQATYYAGEWRPEFDRWVQMQAGMYRGKGRESVAWNSAL
TYDMIFTQPVVYELDRLQMPTLLLIGEKDNTAIGKDAAPAELKARLGNYAQLGKDAARRI
PQATLVEFPDLGHTPQIQAPERFHQALLEGLQTQP


Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus. Special tag in protocol 30: N-terminal HHHHHHTDPALRA, first residue deleted and C-terminal GLCGR.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu