LOADING...
   YP_094990.1;SP19432A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_094990.1    Chemical properties of target construct

Accession: YP_094990.1
Description: gi|52841191|ref|YP_094990.1| hypothetical protein lpg0956 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
Organism: LEGIONELLA PNEUMOPHILA SUBSP. PNEUMOPHILA STR. PHILADELPHIA 1
Residues: 392 aa
Local acc: SP19432A
Target id: 412258
Alias:
Construct: Full: 1-392

  Full Fragment Fragment with tag Fragment with modification Fragment with tag and modification
Residues(aa) 392 392 404 392 404
Molecular Weight (Dalton) 44479.19 44479.19 45933.74 44479.19 45933.74
Isoelectric Point 7.12 7.12 7.26 7.12 7.26
Extinction Coefficient 51800 51800 51800 51800 51800
Gravy -0.42 -0.42 -0.47 -0.42 -0.47
Number of Met 4 4 5 4 5
%Met 1.02 1.02 1.24 1.02 1.24
Number of Cys 3 3 3 3 3
%Cys >0.77 0.77 0.74 0.77 0.74
SEQUENCE  amino acids 404 aa; construct sequence with modification and tag mgsdkihhhhhh
>SP19432A|1-392 gi|52841191|ref|YP_094990.1| hypothetical protein lpg0956 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
mgsdkihhhhhhMKTAHLIWISAFCIAQAHAFTLPRQPTKAYECENCSQLSRENLHDKWE
ITNEPLNNNISNVRRSYGYKERISLEQLQRGVIISTLAPGAVVRITPLQNKSIPELLIKT
PKNQLLPLKEASSLYNQDDEVGNNPLAITKHQAMLQIKPELGYGKFILKSKDITNKYADA
YMISVLDKFSITYLEVETDSLHYQYGDKLKATISLHNDITEYDVNDVDARLVGPKGQVIS
LNLTKLKSNVFEGTATLDSELNDRGENWYLETDVQTEYGQEIIRRSGHTAFSYSIPSASL
MNVKKLSSKPLTFVVTVDVATASRYALQSVLFQKNGKGEARPIQTSQRAQWLEPGKHVLQ
FTFDNHNQLSDDNLYLGYLRLIDYGQLKTVYQYNQPVKLSQLVD

SEQUENCE  amino acids 392 aa; construct sequence without modification or tag
>SP19432A|1-392 gi|52841191|ref|YP_094990.1| hypothetical protein lpg0956 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
MKTAHLIWISAFCIAQAHAFTLPRQPTKAYECENCSQLSRENLHDKWEITNEPLNNNISN
VRRSYGYKERISLEQLQRGVIISTLAPGAVVRITPLQNKSIPELLIKTPKNQLLPLKEAS
SLYNQDDEVGNNPLAITKHQAMLQIKPELGYGKFILKSKDITNKYADAYMISVLDKFSIT
YLEVETDSLHYQYGDKLKATISLHNDITEYDVNDVDARLVGPKGQVISLNLTKLKSNVFE
GTATLDSELNDRGENWYLETDVQTEYGQEIIRRSGHTAFSYSIPSASLMNVKKLSSKPLT
FVVTVDVATASRYALQSVLFQKNGKGEARPIQTSQRAQWLEPGKHVLQFTFDNHNQLSDD
NLYLGYLRLIDYGQLKTVYQYNQPVKLSQLVD

SEQUENCE  amino acids 404 aa; construct sequence with tag but no modification; mgsdkihhhhhh
>SP19432A|1-392 gi|52841191|ref|YP_094990.1| hypothetical protein lpg0956 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
mgsdkihhhhhhMKTAHLIWISAFCIAQAHAFTLPRQPTKAYECENCSQLSRENLHDKWE
ITNEPLNNNISNVRRSYGYKERISLEQLQRGVIISTLAPGAVVRITPLQNKSIPELLIKT
PKNQLLPLKEASSLYNQDDEVGNNPLAITKHQAMLQIKPELGYGKFILKSKDITNKYADA
YMISVLDKFSITYLEVETDSLHYQYGDKLKATISLHNDITEYDVNDVDARLVGPKGQVIS
LNLTKLKSNVFEGTATLDSELNDRGENWYLETDVQTEYGQEIIRRSGHTAFSYSIPSASL
MNVKKLSSKPLTFVVTVDVATASRYALQSVLFQKNGKGEARPIQTSQRAQWLEPGKHVLQ
FTFDNHNQLSDDNLYLGYLRLIDYGQLKTVYQYNQPVKLSQLVD

SEQUENCE  amino acids 392 aa; construct sequence with modification but no tag
>SP19432A|1-392 gi|52841191|ref|YP_094990.1| hypothetical protein lpg0956 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
MKTAHLIWISAFCIAQAHAFTLPRQPTKAYECENCSQLSRENLHDKWEITNEPLNNNISN
VRRSYGYKERISLEQLQRGVIISTLAPGAVVRITPLQNKSIPELLIKTPKNQLLPLKEAS
SLYNQDDEVGNNPLAITKHQAMLQIKPELGYGKFILKSKDITNKYADAYMISVLDKFSIT
YLEVETDSLHYQYGDKLKATISLHNDITEYDVNDVDARLVGPKGQVISLNLTKLKSNVFE
GTATLDSELNDRGENWYLETDVQTEYGQEIIRRSGHTAFSYSIPSASLMNVKKLSSKPLT
FVVTVDVATASRYALQSVLFQKNGKGEARPIQTSQRAQWLEPGKHVLQFTFDNHNQLSDD
NLYLGYLRLIDYGQLKTVYQYNQPVKLSQLVD

SEQUENCE  amino acids 392 aa; full sequence in database
>SP19432A|1-392 gi|52841191|ref|YP_094990.1| hypothetical protein lpg0956 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]
MKTAHLIWISAFCIAQAHAFTLPRQPTKAYECENCSQLSRENLHDKWEITNEPLNNNISN
VRRSYGYKERISLEQLQRGVIISTLAPGAVVRITPLQNKSIPELLIKTPKNQLLPLKEAS
SLYNQDDEVGNNPLAITKHQAMLQIKPELGYGKFILKSKDITNKYADAYMISVLDKFSIT
YLEVETDSLHYQYGDKLKATISLHNDITEYDVNDVDARLVGPKGQVISLNLTKLKSNVFE
GTATLDSELNDRGENWYLETDVQTEYGQEIIRRSGHTAFSYSIPSASLMNVKKLSSKPLT
FVVTVDVATASRYALQSVLFQKNGKGEARPIQTSQRAQWLEPGKHVLQFTFDNHNQLSDD
NLYLGYLRLIDYGQLKTVYQYNQPVKLSQLVD


Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus. Special tag in protocol 30: N-terminal HHHHHHTDPALRA, first residue deleted and C-terminal GLCGR.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu