LOADING...
   YP_001337146.1;SP18574A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001337146.1    Chemical properties of target construct

Accession: YP_001337146.1
Description: gi|152972000|ref|YP_001337146.1| hypothetical protein KPN_03484 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
Organism: Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Residues: 101 aa
Local acc: SP18574A
Target id: 411737
Alias:
Construct: Full: 1-101

  Full Fragment Fragment with tag Fragment with modification Fragment with tag and modification
Residues(aa) 101 101 113 101 113
Molecular Weight (Dalton) 11196.41 11196.41 12650.96 11196.41 12650.96
Isoelectric Point 5.19 5.19 6.20 5.19 6.20
Extinction Coefficient 12490 12490 12490 12490 12490
Gravy -0.06 -0.06 -0.25 -0.06 -0.25
Number of Met 7 7 8 7 8
%Met 6.93 6.93 7.08 6.93 7.08
Number of Cys 3 3 3 3 3
%Cys >2.97 2.97 2.65 2.97 2.65
SEQUENCE  amino acids 113 aa; construct sequence with modification and tag mgsdkihhhhhh
>SP18574A|1-101 gi|152972000|ref|YP_001337146.1| hypothetical protein KPN_03484 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
mgsdkihhhhhhMNLPKALVLTVAATTFCLMTSPAFAVEETTPQNMTCQEFMDMNPKSMT
PVAFWVVNRNTDFSGGDYVDWHEVETVSVPKMLQECHKNPAAKLGDLSAVIKK

SEQUENCE  amino acids 101 aa; construct sequence without modification or tag
>SP18574A|1-101 gi|152972000|ref|YP_001337146.1| hypothetical protein KPN_03484 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MNLPKALVLTVAATTFCLMTSPAFAVEETTPQNMTCQEFMDMNPKSMTPVAFWVVNRNTD
FSGGDYVDWHEVETVSVPKMLQECHKNPAAKLGDLSAVIKK

SEQUENCE  amino acids 113 aa; construct sequence with tag but no modification; mgsdkihhhhhh
>SP18574A|1-101 gi|152972000|ref|YP_001337146.1| hypothetical protein KPN_03484 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
mgsdkihhhhhhMNLPKALVLTVAATTFCLMTSPAFAVEETTPQNMTCQEFMDMNPKSMT
PVAFWVVNRNTDFSGGDYVDWHEVETVSVPKMLQECHKNPAAKLGDLSAVIKK

SEQUENCE  amino acids 101 aa; construct sequence with modification but no tag
>SP18574A|1-101 gi|152972000|ref|YP_001337146.1| hypothetical protein KPN_03484 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MNLPKALVLTVAATTFCLMTSPAFAVEETTPQNMTCQEFMDMNPKSMTPVAFWVVNRNTD
FSGGDYVDWHEVETVSVPKMLQECHKNPAAKLGDLSAVIKK

SEQUENCE  amino acids 101 aa; full sequence in database
>SP18574A|1-101 gi|152972000|ref|YP_001337146.1| hypothetical protein KPN_03484 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MNLPKALVLTVAATTFCLMTSPAFAVEETTPQNMTCQEFMDMNPKSMTPVAFWVVNRNTD
FSGGDYVDWHEVETVSVPKMLQECHKNPAAKLGDLSAVIKK


Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus. Special tag in protocol 30: N-terminal HHHHHHTDPALRA, first residue deleted and C-terminal GLCGR.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu