LOADING...
   ZP_02072838.1;SP13297C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02072838.1    Chemical properties of target construct

Accession: ZP_02072838.1
Description: gi|160891835|ref|ZP_02072838.1| hypothetical protein BACUNI_04292 [Bacteroides uniformis ATCC 8492]
Organism: Bacteroides uniformis
Residues: 130 aa
Local acc: SP13297C
Target id: 409388
Alias:
Construct: Full: 1-130

  Full Fragment Fragment with tag Fragment with modification Fragment with tag and modification
Residues(aa) 130 130 142 130 142
Molecular Weight (Dalton) 14704.22 14704.22 16158.77 14704.22 16158.77
Isoelectric Point 9.63 9.63 9.59 9.63 9.59
Extinction Coefficient 8480 8480 8480 8480 8480
Gravy -0.25 -0.25 -0.38 -0.25 -0.38
Number of Met 3 3 4 3 4
%Met 2.31 2.31 2.82 2.31 2.82
Number of Cys 1 1 1 1 1
%Cys >0.77 0.77 0.70 0.77 0.70
SEQUENCE  amino acids 142 aa; construct sequence with modification and tag mgsdkihhhhhh
>SP13297C|1-130 gi|160891835|ref|ZP_02072838.1| hypothetical protein BACUNI_04292 [Bacteroides uniformis ATCC 8492]
mgsdkihhhhhhMKKRVIFLLTGLFIWTSVLLAQNVPEGVIGAFKEGNSQELNKYLGDKV
DLIIQNKSTHADKRTAEGTMAAFFSNHKVGSFNVNHQGKRDESGFVIGILMTANGNFRVN
CFFRKVQNKYVIHQIRIDKTDE

SEQUENCE  amino acids 130 aa; construct sequence without modification or tag
>SP13297C|1-130 gi|160891835|ref|ZP_02072838.1| hypothetical protein BACUNI_04292 [Bacteroides uniformis ATCC 8492]
MKKRVIFLLTGLFIWTSVLLAQNVPEGVIGAFKEGNSQELNKYLGDKVDLIIQNKSTHAD
KRTAEGTMAAFFSNHKVGSFNVNHQGKRDESGFVIGILMTANGNFRVNCFFRKVQNKYVI
HQIRIDKTDE

SEQUENCE  amino acids 142 aa; construct sequence with tag but no modification; mgsdkihhhhhh
>SP13297C|1-130 gi|160891835|ref|ZP_02072838.1| hypothetical protein BACUNI_04292 [Bacteroides uniformis ATCC 8492]
mgsdkihhhhhhMKKRVIFLLTGLFIWTSVLLAQNVPEGVIGAFKEGNSQELNKYLGDKV
DLIIQNKSTHADKRTAEGTMAAFFSNHKVGSFNVNHQGKRDESGFVIGILMTANGNFRVN
CFFRKVQNKYVIHQIRIDKTDE

SEQUENCE  amino acids 130 aa; construct sequence with modification but no tag
>SP13297C|1-130 gi|160891835|ref|ZP_02072838.1| hypothetical protein BACUNI_04292 [Bacteroides uniformis ATCC 8492]
MKKRVIFLLTGLFIWTSVLLAQNVPEGVIGAFKEGNSQELNKYLGDKVDLIIQNKSTHAD
KRTAEGTMAAFFSNHKVGSFNVNHQGKRDESGFVIGILMTANGNFRVNCFFRKVQNKYVI
HQIRIDKTDE

SEQUENCE  amino acids 130 aa; full sequence in database
>SP13297C|1-130 gi|160891835|ref|ZP_02072838.1| hypothetical protein BACUNI_04292 [Bacteroides uniformis ATCC 8492]
MKKRVIFLLTGLFIWTSVLLAQNVPEGVIGAFKEGNSQELNKYLGDKVDLIIQNKSTHAD
KRTAEGTMAAFFSNHKVGSFNVNHQGKRDESGFVIGILMTANGNFRVNCFFRKVQNKYVI
HQIRIDKTDE


Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus. Special tag in protocol 30: N-terminal HHHHHHTDPALRA, first residue deleted and C-terminal GLCGR.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu