LOADING...
   NP_809341.1;GE2184A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NP_809341.1    Chemical properties of target construct

Accession: NP_809341.1
Description: gi|29345838|ref|NP_809341.1| phenylacetate-coenzyme A ligase [Bacteroides thetaiotaomicron VPI-5482]
Organism: BACTEROIDES THETAIOTAOMICRON VPI-5482
Residues: 435 aa
Local acc: GE2184A
Target id: 396691
Alias:
Construct: Full: 1-435

  Full Fragment Fragment with tag Fragment with modification Fragment with tag and modification
Residues(aa) 435 435 447 435 447
Molecular Weight (Dalton) 49377.07 49377.07 50831.62 49377.07 50831.62
Isoelectric Point 5.94 5.94 6.26 5.94 6.26
Extinction Coefficient 35870 35870 35870 35870 35870
Gravy -0.40 -0.40 -0.43 -0.40 -0.43
Number of Met 15 15 16 15 16
%Met 3.45 3.45 3.58 3.45 3.58
Number of Cys 6 6 6 6 6
%Cys >1.38 1.38 1.34 1.38 1.34
SEQUENCE  amino acids 447 aa; construct sequence with modification and tag mgsdkihhhhhh
>GE2184A|1-435 gi|29345838|ref|NP_809341.1| phenylacetate-coenzyme A ligase [Bacteroides thetaiotaomicron VPI-5482]
mgsdkihhhhhhMSTQYWEEEIEIMSREKLQELQLQRLKKTINIAANSPYYKEVFSKNGI
TGDSIQSLDDIRKIPFTTKSDMRANYPFGLVAGDMKRDGVRIHSSSGTTGNPTVIVHSQH
DLDSWANLVARCLYMVGIRKTDVFQNSSGYGMFTGGLGFQYGAERLGCLTVPAAAGNSKR
QIKFISDFKTTALHAIPSYAIRLAEVFQEEGIDPRETTLKTLVIGAEPHTDEQRRKIERM
LNVKAYNSFGMTEMNGPGVAFECQEQNGMHFWEDCYLVEIIDPETGEPVPEGEIGELVLT
TLDREMMPLIRYRTRDLTRILPGKCPCGRTHLRIDRIKGRSDDMFIIKGVNIFPMQVEKI
LVQFPELGSNYLITLETVNNQDEMIVEVELSDLSTDNYIELEKIRRDIIRQLKDEILVTP
KVKLVKKGSLPQSEGKAVRVKDLRDNK

SEQUENCE  amino acids 435 aa; construct sequence without modification or tag
>GE2184A|1-435 gi|29345838|ref|NP_809341.1| phenylacetate-coenzyme A ligase [Bacteroides thetaiotaomicron VPI-5482]
MSTQYWEEEIEIMSREKLQELQLQRLKKTINIAANSPYYKEVFSKNGITGDSIQSLDDIR
KIPFTTKSDMRANYPFGLVAGDMKRDGVRIHSSSGTTGNPTVIVHSQHDLDSWANLVARC
LYMVGIRKTDVFQNSSGYGMFTGGLGFQYGAERLGCLTVPAAAGNSKRQIKFISDFKTTA
LHAIPSYAIRLAEVFQEEGIDPRETTLKTLVIGAEPHTDEQRRKIERMLNVKAYNSFGMT
EMNGPGVAFECQEQNGMHFWEDCYLVEIIDPETGEPVPEGEIGELVLTTLDREMMPLIRY
RTRDLTRILPGKCPCGRTHLRIDRIKGRSDDMFIIKGVNIFPMQVEKILVQFPELGSNYL
ITLETVNNQDEMIVEVELSDLSTDNYIELEKIRRDIIRQLKDEILVTPKVKLVKKGSLPQ
SEGKAVRVKDLRDNK

SEQUENCE  amino acids 447 aa; construct sequence with tag but no modification; mgsdkihhhhhh
>GE2184A|1-435 gi|29345838|ref|NP_809341.1| phenylacetate-coenzyme A ligase [Bacteroides thetaiotaomicron VPI-5482]
mgsdkihhhhhhMSTQYWEEEIEIMSREKLQELQLQRLKKTINIAANSPYYKEVFSKNGI
TGDSIQSLDDIRKIPFTTKSDMRANYPFGLVAGDMKRDGVRIHSSSGTTGNPTVIVHSQH
DLDSWANLVARCLYMVGIRKTDVFQNSSGYGMFTGGLGFQYGAERLGCLTVPAAAGNSKR
QIKFISDFKTTALHAIPSYAIRLAEVFQEEGIDPRETTLKTLVIGAEPHTDEQRRKIERM
LNVKAYNSFGMTEMNGPGVAFECQEQNGMHFWEDCYLVEIIDPETGEPVPEGEIGELVLT
TLDREMMPLIRYRTRDLTRILPGKCPCGRTHLRIDRIKGRSDDMFIIKGVNIFPMQVEKI
LVQFPELGSNYLITLETVNNQDEMIVEVELSDLSTDNYIELEKIRRDIIRQLKDEILVTP
KVKLVKKGSLPQSEGKAVRVKDLRDNK

SEQUENCE  amino acids 435 aa; construct sequence with modification but no tag
>GE2184A|1-435 gi|29345838|ref|NP_809341.1| phenylacetate-coenzyme A ligase [Bacteroides thetaiotaomicron VPI-5482]
MSTQYWEEEIEIMSREKLQELQLQRLKKTINIAANSPYYKEVFSKNGITGDSIQSLDDIR
KIPFTTKSDMRANYPFGLVAGDMKRDGVRIHSSSGTTGNPTVIVHSQHDLDSWANLVARC
LYMVGIRKTDVFQNSSGYGMFTGGLGFQYGAERLGCLTVPAAAGNSKRQIKFISDFKTTA
LHAIPSYAIRLAEVFQEEGIDPRETTLKTLVIGAEPHTDEQRRKIERMLNVKAYNSFGMT
EMNGPGVAFECQEQNGMHFWEDCYLVEIIDPETGEPVPEGEIGELVLTTLDREMMPLIRY
RTRDLTRILPGKCPCGRTHLRIDRIKGRSDDMFIIKGVNIFPMQVEKILVQFPELGSNYL
ITLETVNNQDEMIVEVELSDLSTDNYIELEKIRRDIIRQLKDEILVTPKVKLVKKGSLPQ
SEGKAVRVKDLRDNK

SEQUENCE  amino acids 435 aa; full sequence in database
>GE2184A|1-435 gi|29345838|ref|NP_809341.1| phenylacetate-coenzyme A ligase [Bacteroides thetaiotaomicron VPI-5482]
MSTQYWEEEIEIMSREKLQELQLQRLKKTINIAANSPYYKEVFSKNGITGDSIQSLDDIR
KIPFTTKSDMRANYPFGLVAGDMKRDGVRIHSSSGTTGNPTVIVHSQHDLDSWANLVARC
LYMVGIRKTDVFQNSSGYGMFTGGLGFQYGAERLGCLTVPAAAGNSKRQIKFISDFKTTA
LHAIPSYAIRLAEVFQEEGIDPRETTLKTLVIGAEPHTDEQRRKIERMLNVKAYNSFGMT
EMNGPGVAFECQEQNGMHFWEDCYLVEIIDPETGEPVPEGEIGELVLTTLDREMMPLIRY
RTRDLTRILPGKCPCGRTHLRIDRIKGRSDDMFIIKGVNIFPMQVEKILVQFPELGSNYL
ITLETVNNQDEMIVEVELSDLSTDNYIELEKIRRDIIRQLKDEILVTPKVKLVKKGSLPQ
SEGKAVRVKDLRDNK


Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus. Special tag in protocol 30: N-terminal HHHHHHTDPALRA, first residue deleted and C-terminal GLCGR.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu