LOADING...
   TM0828;TM0828
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM0828    Chemical properties of target construct

Accession: TM0828
Description: TM0828 sugar kinase, pfkB family
Organism: THERMOTOGA MARITIMA
Residues: 319 aa
Local acc: TM0828
Target id: 282698
Alias:
Construct: Full: 1-319

  Full Fragment Fragment with tag Fragment with modification Fragment with tag and modification
Residues(aa) 319 319 331 319 331
Molecular Weight (Dalton) 35866.53 35866.53 37321.08 35866.53 37321.08
Isoelectric Point 6.28 6.28 6.61 6.28 6.61
Extinction Coefficient 23380 23380 23380 23380 23380
Gravy -0.12 -0.12 -0.18 -0.12 -0.18
Number of Met 8 8 9 8 9
%Met 2.51 2.51 2.72 2.51 2.72
Number of Cys 2 2 2 2 2
%Cys >0.63 0.63 0.60 0.63 0.60
SEQUENCE  amino acids 331 aa; construct sequence with modification and tag mgsdkihhhhhh
>TM0828|1-319 TM0828 sugar kinase, pfkB family
mgsdkihhhhhhMVLTVTLNPALDREIFIEDFQVNRLYRINDLSKTQMSPGGKGINVSIA
LSKLGVPSVATGFVGGYMGKILVEELRKISKLITTNFVYVEGETRENIEIIDEKNKTITA
INFPGPDVTDMDVNHFLRRYKMTLSKVDCVVISGSIPPGVNEGICNELVRLARERGVFVF
VEQTPRLLERIYEGPEFPNVVKPDLRGNHASFLGVDLKTFDDYVKLAEKLAEKSQVSVVS
YEVKNDIVATREGVWLIRSKEEIDTSHLLGAGDAYVAGMVYYFIKHGANFLEMAKFGFAS
ALAATRRKEKYMPDLEAIKKEYDHFTVERVK

SEQUENCE  amino acids 319 aa; construct sequence without modification or tag
>TM0828|1-319 TM0828 sugar kinase, pfkB family
MVLTVTLNPALDREIFIEDFQVNRLYRINDLSKTQMSPGGKGINVSIALSKLGVPSVATG
FVGGYMGKILVEELRKISKLITTNFVYVEGETRENIEIIDEKNKTITAINFPGPDVTDMD
VNHFLRRYKMTLSKVDCVVISGSIPPGVNEGICNELVRLARERGVFVFVEQTPRLLERIY
EGPEFPNVVKPDLRGNHASFLGVDLKTFDDYVKLAEKLAEKSQVSVVSYEVKNDIVATRE
GVWLIRSKEEIDTSHLLGAGDAYVAGMVYYFIKHGANFLEMAKFGFASALAATRRKEKYM
PDLEAIKKEYDHFTVERVK

SEQUENCE  amino acids 331 aa; construct sequence with tag but no modification; mgsdkihhhhhh
>TM0828|1-319 TM0828 sugar kinase, pfkB family
mgsdkihhhhhhMVLTVTLNPALDREIFIEDFQVNRLYRINDLSKTQMSPGGKGINVSIA
LSKLGVPSVATGFVGGYMGKILVEELRKISKLITTNFVYVEGETRENIEIIDEKNKTITA
INFPGPDVTDMDVNHFLRRYKMTLSKVDCVVISGSIPPGVNEGICNELVRLARERGVFVF
VEQTPRLLERIYEGPEFPNVVKPDLRGNHASFLGVDLKTFDDYVKLAEKLAEKSQVSVVS
YEVKNDIVATREGVWLIRSKEEIDTSHLLGAGDAYVAGMVYYFIKHGANFLEMAKFGFAS
ALAATRRKEKYMPDLEAIKKEYDHFTVERVK

SEQUENCE  amino acids 319 aa; construct sequence with modification but no tag
>TM0828|1-319 TM0828 sugar kinase, pfkB family
MVLTVTLNPALDREIFIEDFQVNRLYRINDLSKTQMSPGGKGINVSIALSKLGVPSVATG
FVGGYMGKILVEELRKISKLITTNFVYVEGETRENIEIIDEKNKTITAINFPGPDVTDMD
VNHFLRRYKMTLSKVDCVVISGSIPPGVNEGICNELVRLARERGVFVFVEQTPRLLERIY
EGPEFPNVVKPDLRGNHASFLGVDLKTFDDYVKLAEKLAEKSQVSVVSYEVKNDIVATRE
GVWLIRSKEEIDTSHLLGAGDAYVAGMVYYFIKHGANFLEMAKFGFASALAATRRKEKYM
PDLEAIKKEYDHFTVERVK

SEQUENCE  amino acids 319 aa; full sequence in database
>TM0828|1-319 TM0828 sugar kinase, pfkB family
MVLTVTLNPALDREIFIEDFQVNRLYRINDLSKTQMSPGGKGINVSIALSKLGVPSVATG
FVGGYMGKILVEELRKISKLITTNFVYVEGETRENIEIIDEKNKTITAINFPGPDVTDMD
VNHFLRRYKMTLSKVDCVVISGSIPPGVNEGICNELVRLARERGVFVFVEQTPRLLERIY
EGPEFPNVVKPDLRGNHASFLGVDLKTFDDYVKLAEKLAEKSQVSVVSYEVKNDIVATRE
GVWLIRSKEEIDTSHLLGAGDAYVAGMVYYFIKHGANFLEMAKFGFASALAATRRKEKYM
PDLEAIKKEYDHFTVERVK


Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus. Special tag in protocol 30: N-terminal HHHHHHTDPALRA, first residue deleted and C-terminal GLCGR.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu