LOADING...
   ZP_03779557.1;BAIE
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_03779557.1    Target Constructs

Accession: ZP_03779557.1
Local acc: BA11652B
Description: gi|225570532|ref|ZP_03779557.1| hypothetical protein CLOHYLEM_06634 [Clostridium hylemonae DSM 15053]
Organism: Clostridium hylemonae DSM 15053
Residues: 169 aa
Constructs: 2
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>BA11652B|1:169 tid:421786 alias: stage:pdb deposition(pdb id:4L8O) Full|1:169 CP Pir/Fasta
MSIEERLEALEKEIQKMKDIEEIKKLKGQYFRCLDGKFWDELETTLSPNIVTSYSNGKLV
FHGPKEVTDYFKKAMPREEISMHMGHTPEITIDSETTATGRWYLEDKLIFTEESKYAGSG
VNGGAFYTDKYEKVDGKWYILETGYLRVYEEHFMRDPKIKITMNMHKTK
CDS  cDNA 507 bp
   1 atgagtattg aagaaagatt agaagcattg gaaaaagaga tccagaagat gaaagatatt    60
  61 gaagagataa aaaaattgaa aggccagtat ttccggtgcc ttgacggcaa gttctgggat   120
 121 gaactggaga ctacactctc cccgaacatt gtaacttcct actccaacgg caagcttgtg   180
 181 ttccacggtc caaaggaagt cacagactat tttaagaagg cgatgccgag ggaagaaata   240
 241 agcatgcaca tgggacacac tccggagatc acgatcgaca gtgagactac ggcgacaggc   300
 301 agatggtatc tggaggataa actgatcttt acagaagaaa gcaagtatgc cggttcaggc   360
 361 gtgaacggcg gcgcatttta cacagataag tatgagaagg tggacggcaa atggtatatt   420
 421 cttgagaccg ggtatcttcg tgtttacgag gaacatttta tgcgcgaccc gaagatcaag   480
 481 atcacgatga acatgcacaa aacaaaa   507

Residues: 169 aa
Molecule Weight: 19871.75 Dalton
Number of Met residues: 8
Percentage of Met residues: 4.73 %
Number of Cys residues: 1
Percentage of Cys residues: 0.59 %

>BA11652B|31:169 tid:423032 alias: stage:plasmid purification fragment|31:169 CP Pir/Fasta FRCLDGKFWDELETTLSPNIVTSYSNGKLVFHGPKEVTDYFKKAMPREEISMHMGHTPEI TIDSETTATGRWYLEDKLIFTEESKYAGSGVNGGAFYTDKYEKVDGKWYILETGYLRVYE EHFMRDPKIKITMNMHKTK CDS cDNA 417 bp 1 ttccggtgcc ttgacggcaa gttctgggat gaactggaga ctacactctc cccgaacatt 60 61 gtaacttcct actccaacgg caagcttgtg ttccacggtc caaaggaagt cacagactat 120 121 tttaagaagg cgatgccgag ggaagaaata agcatgcaca tgggacacac tccggagatc 180 181 acgatcgaca gtgagactac ggcgacaggc agatggtatc tggaggataa actgatcttt 240 241 acagaagaaa gcaagtatgc cggttcaggc gtgaacggcg gcgcatttta cacagataag 300 301 tatgagaagg tggacggcaa atggtatatt cttgagaccg ggtatcttcg tgtttacgag 360 361 gaacatttta tgcgcgaccc gaagatcaag atcacgatga acatgcacaa aacaaaa 417 Residues: 139 aa Molecule Weight: 16238.65 Dalton Number of Met residues: 6 Percentage of Met residues: 4.32 % Number of Cys residues: 1 Percentage of Cys residues: 0.72 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu