LOADING...
   ZP_03458806.1;SP13538B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_03458806.1    Target Constructs

Accession: ZP_03458806.1
Local acc: SP13538B
Description: gi|218130002|ref|ZP_03458806.1| hypothetical protein BACEGG_01585 [Bacteroides eggerthii DSM 20697]
Organism: Bacteroides eggerthii DSM 20697
Residues: 150 aa
Constructs: 2
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>SP13538B|25:150 tid:417708 alias: stage:pdb deposition(pdb id:5BYP) fragment|25:150 CP Pir/Fasta
NDGGSDWVGKWQLREYQYPDGKVQKVDSIFYGFQKGSFLAYCMNKSGSYEGFYGYYKLKD
DEISITLWPDNSSGNEAAHEELVNSASYKNFFGWGDTGERTFKVEELTDKKMRLNYEGTK
YVFRKY
CDS  cDNA 378 bp
   1 aatgacggag gttccgattg ggttggaaaa tggcagttgc gtgaatatca gtatcccgac    60
  61 ggtaaagtgc agaaagtgga cagcatcttt tatggctttc aaaaaggtag ctttttggca   120
 121 tattgtatga ataaaagtgg aagctatgaa ggtttttatg gctattataa gttgaaagat   180
 181 gatgaaattt ctataacttt gtggccggat aatagttccg gaaatgaggc agcgcacgag   240
 241 gaactggtga attctgcaag ttataagaat ttctttggct ggggagatac cggtgaaagg   300
 301 acattcaagg ttgaagaact gaccgacaag aagatgcgat tgaactatga gggaacgaaa   360
 361 tatgttttcc gtaagtat   378

Residues: 126 aa
Molecule Weight: 14709.56 Dalton
Number of Met residues: 2
Percentage of Met residues: 1.59 %
Number of Cys residues: 1
Percentage of Cys residues: 0.79 %

>SP13538B|1:150 tid:407520 alias: stage:proposed target Full|1:150 CP Pir/Fasta MKKLLNGTILLLLMCAVSGLTSCMNDGGSDWVGKWQLREYQYPDGKVQKVDSIFYGFQKG SFLAYCMNKSGSYEGFYGYYKLKDDEISITLWPDNSSGNEAAHEELVNSASYKNFFGWGD TGERTFKVEELTDKKMRLNYEGTKYVFRKY CDS cDNA 450 bp 1 atgaaaaaat tgttgaatgg gacaattcta ttacttttga tgtgtgcagt atcgggattg 60 61 acgtcttgta tgaatgacgg aggttccgat tgggttggaa aatggcagtt gcgtgaatat 120 121 cagtatcccg acggtaaagt gcagaaagtg gacagcatct tttatggctt tcaaaaaggt 180 181 agctttttgg catattgtat gaataaaagt ggaagctatg aaggttttta tggctattat 240 241 aagttgaaag atgatgaaat ttctataact ttgtggccgg ataatagttc cggaaatgag 300 301 gcagcgcacg aggaactggt gaattctgca agttataaga atttctttgg ctggggagat 360 361 accggtgaaa ggacattcaa ggttgaagaa ctgaccgaca agaagatgcg attgaactat 420 421 gagggaacga aatatgtttt ccgtaagtat 450 Residues: 150 aa Molecule Weight: 17245.67 Dalton Number of Met residues: 5 Percentage of Met residues: 3.33 % Number of Cys residues: 3 Percentage of Cys residues: 2.00 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu