LOADING...
   ZP_02072838.1;SP13297C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02072838.1    Target Constructs

Accession: ZP_02072838.1
Local acc: SP13297C
Description: gi|160891835|ref|ZP_02072838.1| hypothetical protein BACUNI_04292 [Bacteroides uniformis ATCC 8492]
Organism: Bacteroides uniformis
Residues: 130 aa
Constructs: 2
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>SP13297C|22:130 tid:417916 alias: stage:pdb deposition(pdb id:4Q53) fragment|22:130 CP Pir/Fasta
QNVPEGVIGAFKEGNSQELNKYLGDKVDLIIQNKSTHADKRTAEGTMAAFFSNHKVGSFN
VNHQGKRDESGFVIGILMTANGNFRVNCFFRKVQNKYVIHQIRIDKTDE
CDS  cDNA 327 bp
   1 cagaatgttc ccgagggagt gattggagcc ttcaaggaag gaaactctca ggagctcaac    60
  61 aagtatctgg gtgacaaggt cgatttaatc attcagaata agtcgaccca cgccgataag   120
 121 cggacggcag agggcacaat ggctgctttc ttctccaacc acaaggtcgg cagttttaat   180
 181 gtgaaccatc aggggaagcg cgatgagtcc ggtttcgtca tcggtatctt gatgaccgca   240
 241 aatggaaact ttcgggtgaa ttgtttcttc agaaaagtac agaacaaata tgtcatacat   300
 301 caaataagga tagataaaac agatgaa   327

Residues: 109 aa
Molecule Weight: 12272.26 Dalton
Number of Met residues: 2
Percentage of Met residues: 1.83 %
Number of Cys residues: 1
Percentage of Cys residues: 0.92 %

>SP13297C|1:130 tid:409388 alias: stage:proposed target Full|1:130 CP Pir/Fasta MKKRVIFLLTGLFIWTSVLLAQNVPEGVIGAFKEGNSQELNKYLGDKVDLIIQNKSTHAD KRTAEGTMAAFFSNHKVGSFNVNHQGKRDESGFVIGILMTANGNFRVNCFFRKVQNKYVI HQIRIDKTDE CDS cDNA 390 bp 1 atgaaaaaac gggtaatctt tttgttgacc ggtctcttca tttggacgtc tgtgctgctg 60 61 gcccagaatg ttcccgaggg agtgattgga gccttcaagg aaggaaactc tcaggagctc 120 121 aacaagtatc tgggtgacaa ggtcgattta atcattcaga ataagtcgac ccacgccgat 180 181 aagcggacgg cagagggcac aatggctgct ttcttctcca accacaaggt cggcagtttt 240 241 aatgtgaacc atcaggggaa gcgcgatgag tccggtttcg tcatcggtat cttgatgacc 300 301 gcaaatggaa actttcgggt gaattgtttc ttcagaaaag tacagaacaa atatgtcata 360 361 catcaaataa ggatagataa aacagatgaa 390 Residues: 130 aa Molecule Weight: 14704.22 Dalton Number of Met residues: 3 Percentage of Met residues: 2.31 % Number of Cys residues: 1 Percentage of Cys residues: 0.77 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu