LOADING...
   ZP_02069929.1;SP13538A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02069929.1    Target Constructs

Accession: ZP_02069929.1
Local acc: SP13538A
Description: gi|160888926|ref|ZP_02069929.1| hypothetical protein BACUNI_01346 [Bacteroides uniformis ATCC 8492]
Organism: Bacteroides uniformis
Residues: 135 aa
Constructs: 2
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>SP13538A|21:135 tid:417932 alias: stage:pdb deposition(pdb id:4QRL) fragment|21:135 CP Pir/Fasta
CMNGGGDLAGKWQLRQYQYADGTSEKVDSVFYNFQKGSFSAICLLKDGGLTTFFGNYSLK
GAEISIILLPESVNDKNYDTYFGWPEGKCTFKVEDLSYSSLRLEYEGTKSIFRKF
CDS  cDNA 345 bp
   1 tgcatgaatg gtgggggtga cttggccggt aagtggcagt tgcgtcagta tcaatatgcc    60
  61 gacggtacat cagagaaggt ggacagtgta ttctataatt ttcaaaaagg aagtttttct   120
 121 gccatatgtt tgttgaaaga tggagggttg actacgtttt ttggaaatta ttctttgaaa   180
 181 ggtgctgaaa tttccattat tttgttgcct gaaagcgtta acgataaaaa ttatgatact   240
 241 tatttcgggt ggccggaagg aaaatgtacc tttaaagtag aagatttgtc ctactcttca   300
 301 ttgcgtttgg aatatgaggg cacgaaatct atttttcgaa aattt   345

Residues: 115 aa
Molecule Weight: 12994.94 Dalton
Number of Met residues: 1
Percentage of Met residues: 0.87 %
Number of Cys residues: 3
Percentage of Cys residues: 2.61 %

>SP13538A|1:135 tid:409405 alias: stage:proposed target Full|1:135 CP Pir/Fasta MMKLHLKYLWIVLVACTLTACMNGGGDLAGKWQLRQYQYADGTSEKVDSVFYNFQKGSFS AICLLKDGGLTTFFGNYSLKGAEISIILLPESVNDKNYDTYFGWPEGKCTFKVEDLSYSS LRLEYEGTKSIFRKF CDS cDNA 405 bp 1 atgatgaaat tgcatttaaa atatctttgg attgtattgg tggcttgtac tttgaccgct 60 61 tgcatgaatg gtgggggtga cttggccggt aagtggcagt tgcgtcagta tcaatatgcc 120 121 gacggtacat cagagaaggt ggacagtgta ttctataatt ttcaaaaagg aagtttttct 180 181 gccatatgtt tgttgaaaga tggagggttg actacgtttt ttggaaatta ttctttgaaa 240 241 ggtgctgaaa tttccattat tttgttgcct gaaagcgtta acgataaaaa ttatgatact 300 301 tatttcgggt ggccggaagg aaaatgtacc tttaaagtag aagatttgtc ctactcttca 360 361 ttgcgtttgg aatatgaggg cacgaaatct atttttcgaa aattt 405 Residues: 135 aa Molecule Weight: 15324.81 Dalton Number of Met residues: 3 Percentage of Met residues: 2.22 % Number of Cys residues: 4 Percentage of Cys residues: 2.96 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu