LOADING...
   ZP_02067971.1;ZP_02067971.1
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02067971.1    Target Constructs

Accession: ZP_02067971.1
Local acc: SP16984B
Description: gi|160886968|ref|ZP_02067971.1| hypothetical protein BACOVA_04982 [Bacteroides ovatus ATCC 8483]
Organism: Bacteroides ovatus
Residues: 534 aa
Constructs: 4
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>SP16984B|26:534 tid:417033 alias: stage:pdb deposition(pdb id:4EPS) fragment|26:534 CP Pir/Fasta
EEEVPGNVRNGIVLNVTDTGIISNEPSTRTEDTGFVTTFTQGDQIGLFAVKDGAILDEIN
NMPFTFNGSSWSGKPILYDDRLVGVNFYAYYPYQSEMTGKTDLIGDDFFAPLAAGWELTT
EQSDQKAYAKQDLMTSNATALIGENGNYSLSFQLTHRMSLVVVKLPSTRYIFTDAEGVAM
PEETPYVAMSVDVAFYLDNVEEGTKISPYYDAKKDEYRLLRKPSSENQIIGHYNDKQCTL
DTAEKMKEGKYKRFVVDGGYKEVTHHLQVGDYYYADGSVVSGNEAEPAKDNCIGIVCWVG
NPMPSVLYKDVAGTPYTATNDALLRSHPNCVHGLVMSLYTETGKFSPALTQSIHDWFMTT
SFTSSYVSVTGYYDANENNKNKPLRFLGYNNSEVLDLYYDTFKTDFECFQYQDDCESSFP
SPSITTGWYVPSSGELVALQDKDNSLESKLNTKLIKVSDKTMDISATYWSSTERNNKNMY
IVTYSKTAGSAGTGGVKTNTYTYRFFLGF
CDS  cDNA 1527 bp
   1 gaggaagaag ttccgggaaa tgtacggaat gggattgtac tgaacgtgac tgatacaggg    60
  61 ataattagca atgaaccgtc tacgcgtaca gaagatacgg gattcgtcac gacctttaca   120
 121 caaggcgacc agattggact gttcgccgtg aaagacggtg cgatattgga cgaaatcaat   180
 181 aatatgcctt tcactttcaa tggttcgagc tggtcgggta aaccgatatt gtatgatgat   240
 241 cgtctggtgg gagtgaattt ctatgcttac tatccttatc aatcggaaat gacaggaaaa   300
 301 acggatttga taggtgatga tttttttgct cctctggcag ccggttggga attgacaaca   360
 361 gaacaaagtg atcagaaagc atatgcgaaa caggatttga tgacctcaaa tgcaactgca   420
 421 ttgattggtg agaacggaaa ctactcattg agctttcagt taacacaccg tatgagcttg   480
 481 gttgttgtga agttgccttc cactcgttat atctttacag atgccgaagg agtggcaatg   540
 541 ccggaagaaa ctccttatgt tgctatgtct gtcgatgtag ctttttatct tgataatgtg   600
 601 gaggaaggaa ctaaaatttc tccttattat gacgcaaaga aagatgaata tcgtttgcta   660
 661 agaaaaccgt cttcggaaaa tcagattatc ggtcattata atgataagca atgtacgctt   720
 721 gatacggctg aaaagatgaa agaaggaaaa tacaaacgtt ttgttgtcga tggtggatat   780
 781 aaagaggtga cccatcatct gcaggtaggc gattattatt atgcagatgg aagtgtggta   840
 841 agtggcaatg aagcagaacc tgcaaaggat aattgtattg gaatcgtttg ttgggtggga   900
 901 aatccgatgc cttctgtgtt gtataaagat gtggcgggaa ctccctatac tgccactaat   960
 961 gatgcattgc tccgttcgca tcccaattgt gttcatgggt tagttatgag cctctataca  1020
1021 gaaacgggca aattctctcc tgctcttact caaagtatac acgactggtt tatgactact  1080
1081 tcgtttactt cttcttatgt atctgttacc ggatattatg atgcaaatga aaataataaa  1140
1141 aacaaacctc ttcgcttttt gggatataac aactcggaag tattagattt gtactacgat  1200
1201 actttcaaaa cagattttga atgtttccaa tatcaggatg attgtgaaag tagcttcccg  1260
1261 tctccgtcta taactaccgg ttggtatgtg ccttccagtg gggaacttgt tgctttgcag  1320
1321 gataaagata attctttaga gagtaagctg aatactaagt tgataaaagt atcggataaa  1380
1381 acaatggata tatctgctac ctattggagt agtacggaac ggaataataa gaatatgtac  1440
1441 attgttactt attctaaaac agctggctcg gcaggaaccg gtggtgtcaa gaccaatact  1500
1501 tacacttatc gttttttcct gggattc  1527

Residues: 509 aa
Molecule Weight: 56848.28 Dalton
Number of Met residues: 12
Percentage of Met residues: 2.36 %
Number of Cys residues: 6
Percentage of Cys residues: 1.18 %

>SP16984B|55:534 tid:429851 alias: stage:plasmid purification fragment|55:534 CP Pir/Fasta TEDTGFVTTFTQGDQIGLFAVKDGAILDEINNMPFTFNGSSWSGKPILYDDRLVGVNFYA YYPYQSEMTGKTDLIGDDFFAPLAAGWELTTEQSDQKAYAKQDLMTSNATALIGENGNYS LSFQLTHRMSLVVVKLPSTRYIFTDAEGVAMPEETPYVAMSVDVAFYLDNVEEGTKISPY YDAKKDEYRLLRKPSSENQIIGHYNDKQCTLDTAEKMKEGKYKRFVVDGGYKEVTHHLQV GDYYYADGSVVSGNEAEPAKDNCIGIVCWVGNPMPSVLYKDVAGTPYTATNDALLRSHPN CVHGLVMSLYTETGKFSPALTQSIHDWFMTTSFTSSYVSVTGYYDANENNKNKPLRFLGY NNSEVLDLYYDTFKTDFECFQYQDDCESSFPSPSITTGWYVPSSGELVALQDKDNSLESK LNTKLIKVSDKTMDISATYWSSTERNNKNMYIVTYSKTAGSAGTGGVKTNTYTYRFFLGF CDS cDNA 1440 bp 1 acagaagata cgggattcgt cacgaccttt acacaaggcg accagattgg actgttcgcc 60 61 gtgaaagacg gtgcgatatt ggacgaaatc aataatatgc ctttcacttt caatggttcg 120 121 agctggtcgg gtaaaccgat attgtatgat gatcgtctgg tgggagtgaa tttctatgct 180 181 tactatcctt atcaatcgga aatgacagga aaaacggatt tgataggtga tgattttttt 240 241 gctcctctgg cagccggttg ggaattgaca acagaacaaa gtgatcagaa agcatatgcg 300 301 aaacaggatt tgatgacctc aaatgcaact gcattgattg gtgagaacgg aaactactca 360 361 ttgagctttc agttaacaca ccgtatgagc ttggttgttg tgaagttgcc ttccactcgt 420 421 tatatcttta cagatgccga aggagtggca atgccggaag aaactcctta tgttgctatg 480 481 tctgtcgatg tagcttttta tcttgataat gtggaggaag gaactaaaat ttctccttat 540 541 tatgacgcaa agaaagatga atatcgtttg ctaagaaaac cgtcttcgga aaatcagatt 600 601 atcggtcatt ataatgataa gcaatgtacg cttgatacgg ctgaaaagat gaaagaagga 660 661 aaatacaaac gttttgttgt cgatggtgga tataaagagg tgacccatca tctgcaggta 720 721 ggcgattatt attatgcaga tggaagtgtg gtaagtggca atgaagcaga acctgcaaag 780 781 gataattgta ttggaatcgt ttgttgggtg ggaaatccga tgccttctgt gttgtataaa 840 841 gatgtggcgg gaactcccta tactgccact aatgatgcat tgctccgttc gcatcccaat 900 901 tgtgttcatg ggttagttat gagcctctat acagaaacgg gcaaattctc tcctgctctt 960 961 actcaaagta tacacgactg gtttatgact acttcgttta cttcttctta tgtatctgtt 1020 1021 accggatatt atgatgcaaa tgaaaataat aaaaacaaac ctcttcgctt tttgggatat 1080 1081 aacaactcgg aagtattaga tttgtactac gatactttca aaacagattt tgaatgtttc 1140 1141 caatatcagg atgattgtga aagtagcttc ccgtctccgt ctataactac cggttggtat 1200 1201 gtgccttcca gtggggaact tgttgctttg caggataaag ataattcttt agagagtaag 1260 1261 ctgaatacta agttgataaa agtatcggat aaaacaatgg atatatctgc tacctattgg 1320 1321 agtagtacgg aacggaataa taagaatatg tacattgtta cttattctaa aacagctggc 1380 1381 tcggcaggaa ccggtggtgt caagaccaat acttacactt atcgtttttt cctgggattc 1440 Residues: 480 aa Molecule Weight: 53756.07 Dalton Number of Met residues: 12 Percentage of Met residues: 2.50 % Number of Cys residues: 6 Percentage of Cys residues: 1.25 %

>SP16984B|1:534 tid:408414 alias: stage:proposed target Full|1:534 CP Pir/Fasta MKQYKLMQVALLAILLFGWAGCSQNEEEVPGNVRNGIVLNVTDTGIISNEPSTRTEDTGF VTTFTQGDQIGLFAVKDGAILDEINNMPFTFNGSSWSGKPILYDDRLVGVNFYAYYPYQS EMTGKTDLIGDDFFAPLAAGWELTTEQSDQKAYAKQDLMTSNATALIGENGNYSLSFQLT HRMSLVVVKLPSTRYIFTDAEGVAMPEETPYVAMSVDVAFYLDNVEEGTKISPYYDAKKD EYRLLRKPSSENQIIGHYNDKQCTLDTAEKMKEGKYKRFVVDGGYKEVTHHLQVGDYYYA DGSVVSGNEAEPAKDNCIGIVCWVGNPMPSVLYKDVAGTPYTATNDALLRSHPNCVHGLV MSLYTETGKFSPALTQSIHDWFMTTSFTSSYVSVTGYYDANENNKNKPLRFLGYNNSEVL DLYYDTFKTDFECFQYQDDCESSFPSPSITTGWYVPSSGELVALQDKDNSLESKLNTKLI KVSDKTMDISATYWSSTERNNKNMYIVTYSKTAGSAGTGGVKTNTYTYRFFLGF CDS cDNA 1602 bp 1 atgaaacaat ataaacttat gcaagtggcc ttgctggcaa tcctattgtt cggttgggct 60 61 ggttgttctc aaaatgagga agaagttccg ggaaatgtac ggaatgggat tgtactgaac 120 121 gtgactgata cagggataat tagcaatgaa ccgtctacgc gtacagaaga tacgggattc 180 181 gtcacgacct ttacacaagg cgaccagatt ggactgttcg ccgtgaaaga cggtgcgata 240 241 ttggacgaaa tcaataatat gcctttcact ttcaatggtt cgagctggtc gggtaaaccg 300 301 atattgtatg atgatcgtct ggtgggagtg aatttctatg cttactatcc ttatcaatcg 360 361 gaaatgacag gaaaaacgga tttgataggt gatgattttt ttgctcctct ggcagccggt 420 421 tgggaattga caacagaaca aagtgatcag aaagcatatg cgaaacagga tttgatgacc 480 481 tcaaatgcaa ctgcattgat tggtgagaac ggaaactact cattgagctt tcagttaaca 540 541 caccgtatga gcttggttgt tgtgaagttg ccttccactc gttatatctt tacagatgcc 600 601 gaaggagtgg caatgccgga agaaactcct tatgttgcta tgtctgtcga tgtagctttt 660 661 tatcttgata atgtggagga aggaactaaa atttctcctt attatgacgc aaagaaagat 720 721 gaatatcgtt tgctaagaaa accgtcttcg gaaaatcaga ttatcggtca ttataatgat 780 781 aagcaatgta cgcttgatac ggctgaaaag atgaaagaag gaaaatacaa acgttttgtt 840 841 gtcgatggtg gatataaaga ggtgacccat catctgcagg taggcgatta ttattatgca 900 901 gatggaagtg tggtaagtgg caatgaagca gaacctgcaa aggataattg tattggaatc 960 961 gtttgttggg tgggaaatcc gatgccttct gtgttgtata aagatgtggc gggaactccc 1020 1021 tatactgcca ctaatgatgc attgctccgt tcgcatccca attgtgttca tgggttagtt 1080 1081 atgagcctct atacagaaac gggcaaattc tctcctgctc ttactcaaag tatacacgac 1140 1141 tggtttatga ctacttcgtt tacttcttct tatgtatctg ttaccggata ttatgatgca 1200 1201 aatgaaaata ataaaaacaa acctcttcgc tttttgggat ataacaactc ggaagtatta 1260 1261 gatttgtact acgatacttt caaaacagat tttgaatgtt tccaatatca ggatgattgt 1320 1321 gaaagtagct tcccgtctcc gtctataact accggttggt atgtgccttc cagtggggaa 1380 1381 cttgttgctt tgcaggataa agataattct ttagagagta agctgaatac taagttgata 1440 1441 aaagtatcgg ataaaacaat ggatatatct gctacctatt ggagtagtac ggaacggaat 1500 1501 aataagaata tgtacattgt tacttattct aaaacagctg gctcggcagg aaccggtggt 1560 1561 gtcaagacca atacttacac ttatcgtttt ttcctgggat tc 1602 Residues: 534 aa Molecule Weight: 59657.58 Dalton Number of Met residues: 14 Percentage of Met residues: 2.62 % Number of Cys residues: 7 Percentage of Cys residues: 1.31 %

>SP16984B|55:534 tid:429784 alias: stage:proposed target fragment|55:534 CP Pir/Fasta TEDTGFVTTFTQGDQIGLFAVKDGAILDEINNMPFTFNGSSWSGKPILYDDRLVGVNFYA YYPYQSEMTGKTDLIGDDFFAPLAAGWELTTEQSDQKAYAKQDLMTSNATALIGENGNYS LSFQLTHRMSLVVVKLPSTRYIFTDAEGVAMPEETPYVAMSVDVAFYLDNVEEGTKISPY YDAKKDEYRLLRKPSSENQIIGHYNDKQCTLDTAEKMKEGKYKRFVVDGGYKEVTHHLQV GDYYYADGSVVSGNEAEPAKDNCIGIVCWVGNPMPSVLYKDVAGTPYTATNDALLRSHPN CVHGLVMSLYTETGKFSPALTQSIHDWFMTTSFTSSYVSVTGYYDANENNKNKPLRFLGY NNSEVLDLYYDTFKTDFECFQYQDDCESSFPSPSITTGWYVPSSGELVALQDKDNSLESK LNTKLIKVSDKTMDISATYWSSTERNNKNMYIVTYSKTAGSAGTGGVKTNTYTYRFFLGF CDS cDNA 1440 bp 1 acagaagata cgggattcgt cacgaccttt acacaaggcg accagattgg actgttcgcc 60 61 gtgaaagacg gtgcgatatt ggacgaaatc aataatatgc ctttcacttt caatggttcg 120 121 agctggtcgg gtaaaccgat attgtatgat gatcgtctgg tgggagtgaa tttctatgct 180 181 tactatcctt atcaatcgga aatgacagga aaaacggatt tgataggtga tgattttttt 240 241 gctcctctgg cagccggttg ggaattgaca acagaacaaa gtgatcagaa agcatatgcg 300 301 aaacaggatt tgatgacctc aaatgcaact gcattgattg gtgagaacgg aaactactca 360 361 ttgagctttc agttaacaca ccgtatgagc ttggttgttg tgaagttgcc ttccactcgt 420 421 tatatcttta cagatgccga aggagtggca atgccggaag aaactcctta tgttgctatg 480 481 tctgtcgatg tagcttttta tcttgataat gtggaggaag gaactaaaat ttctccttat 540 541 tatgacgcaa agaaagatga atatcgtttg ctaagaaaac cgtcttcgga aaatcagatt 600 601 atcggtcatt ataatgataa gcaatgtacg cttgatacgg ctgaaaagat gaaagaagga 660 661 aaatacaaac gttttgttgt cgatggtgga tataaagagg tgacccatca tctgcaggta 720 721 ggcgattatt attatgcaga tggaagtgtg gtaagtggca atgaagcaga acctgcaaag 780 781 gataattgta ttggaatcgt ttgttgggtg ggaaatccga tgccttctgt gttgtataaa 840 841 gatgtggcgg gaactcccta tactgccact aatgatgcat tgctccgttc gcatcccaat 900 901 tgtgttcatg ggttagttat gagcctctat acagaaacgg gcaaattctc tcctgctctt 960 961 actcaaagta tacacgactg gtttatgact acttcgttta cttcttctta tgtatctgtt 1020 1021 accggatatt atgatgcaaa tgaaaataat aaaaacaaac ctcttcgctt tttgggatat 1080 1081 aacaactcgg aagtattaga tttgtactac gatactttca aaacagattt tgaatgtttc 1140 1141 caatatcagg atgattgtga aagtagcttc ccgtctccgt ctataactac cggttggtat 1200 1201 gtgccttcca gtggggaact tgttgctttg caggataaag ataattcttt agagagtaag 1260 1261 ctgaatacta agttgataaa agtatcggat aaaacaatgg atatatctgc tacctattgg 1320 1321 agtagtacgg aacggaataa taagaatatg tacattgtta cttattctaa aacagctggc 1380 1381 tcggcaggaa ccggtggtgt caagaccaat acttacactt atcgtttttt cctgggattc 1440 Residues: 480 aa Molecule Weight: 53756.07 Dalton Number of Met residues: 12 Percentage of Met residues: 2.50 % Number of Cys residues: 6 Percentage of Cys residues: 1.25 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu