LOADING...
   ZP_02067350.1;SP13839C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02067350.1    Target Constructs

Accession: ZP_02067350.1
Local acc: SP13839C
Description: gi|160886347|ref|ZP_02067350.1| hypothetical protein BACOVA_04357 [Bacteroides ovatus ATCC 8483]
Organism: Bacteroides ovatus
Residues: 605 aa
Constructs: 2
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>SP13839C|21:605 tid:419057 alias: stage:pdb deposition(pdb id:4ZRX) fragment|21:605 CP Pir/Fasta
QKKENYYVKHVEFPQSATIEQKVDMAARLVPTPQQYAWQQMELTAFLHFGINTFTGREWG
DGKEDPALFNPSELDAEQWVRTLKEAGFKMVLLTAKHHDGFCLWPTATTKHSVASSPWKN
GQGDVVKELRAACDKYDMKFGVYLSPWDRNAECYGDSPRYNDFFIRQLTELLTNYGEVHE
VWFDGANGEGPNGKKQVYDWDAFYQTIQRLQPKAVMAIMGDDVRWVGNEKGVGRETEWNA
TVLTPGIYARSQENNKRLGVFSKAEDLGSRKILEKATELFWYPSEVDVSIRPGWFYHAEE
DGKVKSLKHLSDIYFQSVGYNSVLLLNIPPDRRGLIHEADIKRLKEFADYRQQTFADNRV
KNGRKYWSTTSGGEAVYALKSKSEINLVMLQEDITKGQRVEAFTVEALTDNGWKEVGKGT
TIGYKRMLRFPAVNANKLRVRIDECRLTAYVSQVAAYYAEPLQEETTKEDWNNLPRSGWK
QVAASPLTIDLGKTVTLSSFTYAPSKAEVKPTMAFRYQFFVSMDGKSWKEVPASGEFSNI
MHNPLPQTVAFSQKVQARFIKLEATTPDATVAKVNMNEIGVMVIP
CDS  cDNA 1755 bp
   1 cagaaaaaag aaaattacta tgtgaagcat gttgaatttc ctcaaagtgc aactatcgaa    60
  61 cagaaggttg atatggcagc gcgtctggta cctactccac agcaatacgc ttggcaacaa   120
 121 atggaattaa cagctttcct tcattttggt atcaacacct ttaccggacg tgaatggggg   180
 181 gacgggaaag aagatcccgc gctctttaat ccttcggaac tggatgctga acaatgggta   240
 241 cgtaccctca aggaagccgg ctttaaaatg gtgcttctga ctgcaaaaca tcacgacggt   300
 301 ttctgccttt ggccaacggc tactaccaaa cattccgtgg cctcttctcc ttggaaaaac   360
 361 ggacaaggcg atgtagtgaa agaacttcgt gctgcctgtg acaaatatga tatgaagttt   420
 421 ggagtatatc tttctccctg ggaccggaat gcggaatgtt atggagactc tccccgttac   480
 481 aatgattttt ttattcggca attgacggaa ttgctcacca attatggtga agtacatgaa   540
 541 gtctggttcg acggggcgaa tggagaaggt ccgaacggaa agaagcaagt gtatgactgg   600
 601 gacgcttttt accaaaccat ccaacgcctc caacccaaag ctgtgatggc aattatgggg   660
 661 gatgatgtcc gctgggtcgg aaacgagaaa ggagtaggcc gtgaaacgga atggaacgca   720
 721 actgtgttga ctcccggtat atatgcccgt tcacaagaga acaacaaacg tttgggtgtt   780
 781 ttcagtaaag cagaggattt gggaagtcgt aagatattgg agaaagctac ggaattattc   840
 841 tggtatcctt cggaagtcga cgtatctatc cgtccgggat ggttctatca tgcggaggaa   900
 901 gatggtaaag tgaaatcttt gaagcattta tcagatattt atttccagtc ggtaggatat   960
 961 aattcagtgc ttctactgaa tattccacct gaccggaggg gactgattca tgaagctgat  1020
1021 atcaagcggt tgaaagagtt tgctgattat cggcaacaaa cgtttgctga caaccgggtg  1080
1081 aaaaacggaa gaaaatactg gagcactact tcgggcggtg aggctgtcta tgccttgaag  1140
1141 tccaaatcgg aaatcaatct ggtcatgttg caggaagata taacgaaagg gcagagggta  1200
1201 gaggctttta ctgtggaagc cttgacggat aatggctgga aagaagtagg aaaaggtacg  1260
1261 acgataggat ataaacgtat gttgcgcttt ccggcagtta atgccaataa gctccgggtg  1320
1321 agaatagacg agtgccggtt gactgcttac gttagtcagg ttgccgctta ttatgcagaa  1380
1381 cctttgcagg aagaaacaac gaaagaagac tggaataatt tgccgcgttc cggatggaaa  1440
1441 caggttgctg cttctccatt aacgattgat ttggggaaga cggtaacatt gagcagtttc  1500
1501 acgtacgcgc cttcaaaagc ggaggtaaag ccgacgatgg cattccgtta tcaattcttt  1560
1561 gtaagcatgg atggtaagag ctggaaagaa gtgcctgcca gtggagagtt cagcaatatt  1620
1621 atgcataatc cgttgccaca gacggttgct ttcagtcaga aagtacaggc acgtttcatt  1680
1681 aaactggagg ccactacacc tgatgctacc gttgctaaag taaatatgaa tgaaataggg  1740
1741 gtgatggtga ttccc  1755

Residues: 585 aa
Molecule Weight: 66622.17 Dalton
Number of Met residues: 13
Percentage of Met residues: 2.22 %
Number of Cys residues: 4
Percentage of Cys residues: 0.68 %

>SP13839C|1:605 tid:408179 alias: stage:proposed target Full|1:605 CP Pir/Fasta MNKLLTSLLLSVTLMSGAQAQKKENYYVKHVEFPQSATIEQKVDMAARLVPTPQQYAWQQ MELTAFLHFGINTFTGREWGDGKEDPALFNPSELDAEQWVRTLKEAGFKMVLLTAKHHDG FCLWPTATTKHSVASSPWKNGQGDVVKELRAACDKYDMKFGVYLSPWDRNAECYGDSPRY NDFFIRQLTELLTNYGEVHEVWFDGANGEGPNGKKQVYDWDAFYQTIQRLQPKAVMAIMG DDVRWVGNEKGVGRETEWNATVLTPGIYARSQENNKRLGVFSKAEDLGSRKILEKATELF WYPSEVDVSIRPGWFYHAEEDGKVKSLKHLSDIYFQSVGYNSVLLLNIPPDRRGLIHEAD IKRLKEFADYRQQTFADNRVKNGRKYWSTTSGGEAVYALKSKSEINLVMLQEDITKGQRV EAFTVEALTDNGWKEVGKGTTIGYKRMLRFPAVNANKLRVRIDECRLTAYVSQVAAYYAE PLQEETTKEDWNNLPRSGWKQVAASPLTIDLGKTVTLSSFTYAPSKAEVKPTMAFRYQFF VSMDGKSWKEVPASGEFSNIMHNPLPQTVAFSQKVQARFIKLEATTPDATVAKVNMNEIG VMVIP CDS cDNA 1815 bp 1 atgaataaac tactaacctc tcttttattg tctgttactc tcatgagtgg agcgcaggcg 60 61 cagaaaaaag aaaattacta tgtgaagcat gttgaatttc ctcaaagtgc aactatcgaa 120 121 cagaaggttg atatggcagc gcgtctggta cctactccac agcaatacgc ttggcaacaa 180 181 atggaattaa cagctttcct tcattttggt atcaacacct ttaccggacg tgaatggggg 240 241 gacgggaaag aagatcccgc gctctttaat ccttcggaac tggatgctga acaatgggta 300 301 cgtaccctca aggaagccgg ctttaaaatg gtgcttctga ctgcaaaaca tcacgacggt 360 361 ttctgccttt ggccaacggc tactaccaaa cattccgtgg cctcttctcc ttggaaaaac 420 421 ggacaaggcg atgtagtgaa agaacttcgt gctgcctgtg acaaatatga tatgaagttt 480 481 ggagtatatc tttctccctg ggaccggaat gcggaatgtt atggagactc tccccgttac 540 541 aatgattttt ttattcggca attgacggaa ttgctcacca attatggtga agtacatgaa 600 601 gtctggttcg acggggcgaa tggagaaggt ccgaacggaa agaagcaagt gtatgactgg 660 661 gacgcttttt accaaaccat ccaacgcctc caacccaaag ctgtgatggc aattatgggg 720 721 gatgatgtcc gctgggtcgg aaacgagaaa ggagtaggcc gtgaaacgga atggaacgca 780 781 actgtgttga ctcccggtat atatgcccgt tcacaagaga acaacaaacg tttgggtgtt 840 841 ttcagtaaag cagaggattt gggaagtcgt aagatattgg agaaagctac ggaattattc 900 901 tggtatcctt cggaagtcga cgtatctatc cgtccgggat ggttctatca tgcggaggaa 960 961 gatggtaaag tgaaatcttt gaagcattta tcagatattt atttccagtc ggtaggatat 1020 1021 aattcagtgc ttctactgaa tattccacct gaccggaggg gactgattca tgaagctgat 1080 1081 atcaagcggt tgaaagagtt tgctgattat cggcaacaaa cgtttgctga caaccgggtg 1140 1141 aaaaacggaa gaaaatactg gagcactact tcgggcggtg aggctgtcta tgccttgaag 1200 1201 tccaaatcgg aaatcaatct ggtcatgttg caggaagata taacgaaagg gcagagggta 1260 1261 gaggctttta ctgtggaagc cttgacggat aatggctgga aagaagtagg aaaaggtacg 1320 1321 acgataggat ataaacgtat gttgcgcttt ccggcagtta atgccaataa gctccgggtg 1380 1381 agaatagacg agtgccggtt gactgcttac gttagtcagg ttgccgctta ttatgcagaa 1440 1441 cctttgcagg aagaaacaac gaaagaagac tggaataatt tgccgcgttc cggatggaaa 1500 1501 caggttgctg cttctccatt aacgattgat ttggggaaga cggtaacatt gagcagtttc 1560 1561 acgtacgcgc cttcaaaagc ggaggtaaag ccgacgatgg cattccgtta tcaattcttt 1620 1621 gtaagcatgg atggtaagag ctggaaagaa gtgcctgcca gtggagagtt cagcaatatt 1680 1681 atgcataatc cgttgccaca gacggttgct ttcagtcaga aagtacaggc acgtttcatt 1740 1741 aaactggagg ccactacacc tgatgctacc gttgctaaag taaatatgaa tgaaataggg 1800 1801 gtgatggtga ttccc 1815 Residues: 605 aa Molecule Weight: 68695.58 Dalton Number of Met residues: 15 Percentage of Met residues: 2.48 % Number of Cys residues: 4 Percentage of Cys residues: 0.66 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu