LOADING...
   ZP_02067074.1;SP17169A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02067074.1    Target Constructs

Accession: ZP_02067074.1
Local acc: SP17169A
Description: gi|160886071|ref|ZP_02067074.1| hypothetical protein BACOVA_04078 [Bacteroides ovatus ATCC 8483]
Organism: Bacteroides ovatus
Residues: 370 aa
Constructs: 2
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>SP17169A|25:370 tid:417104 alias: stage:pdb deposition(pdb id:3UP6) fragment|25:370 CP Pir/Fasta
DVAYELPAHTTRAQLSIDLVNNGDVEQQEKINSMRFIVFGSTPGGVRLDVNEHILLSTPE
TATDIDAQLLEVTSSNDILVVVIANEPQSLTSQLDGIANLLTLQEMIYDISSILNSDGQI
ISATGMPMTGVIRDISIAPDETKTVQMVIERAVARVDVFIEAIDGGAVTGYTAGSTSVTL
HNFSHDSYFVMGNVGNGTRDNADSSKNYGKVKEDVSESNLLTHSWTAATTETWAYSSAPG
AENRKLLCSFYTAERLFKSDYSDRLSISMANVLKGPSDVTGITGKVIESVTKVDGTGSPT
AQPFTEIRRNNVYQVTARVGKIGIQILTISVEDWGERQDIDLDMDL
CDS  cDNA 1038 bp
   1 gatgtggctt atgagttgcc tgcccatact acccgggcgc aacttagcat cgacttggtg    60
  61 aacaatgggg atgtggaaca acaggagaag ataaactcca tgcggtttat cgtattcggc   120
 121 agcacgcccg gtggcgtgag gctggatgtg aatgaacaca tcctgttgag cactccggag   180
 181 acagctactg atatagatgc gcaacttctc gaagtgactt ccagcaatga tatcctggtc   240
 241 gtagttattg ccaacgaacc gcagagtctc acaagccaac ttgacggtat agctaatctt   300
 301 ttgacgttgc aagagatgat ttacgacatc tccagcatac tgaatagtga cgggcagatt   360
 361 atttcggcga ccggaatgcc tatgacagga gtgatccggg atatatccat agcacccgat   420
 421 gaaaccaaaa cagtgcaaat ggtaatcgaa cgtgccgtag cccgggtaga tgtctttatc   480
 481 gaagctatag acggcggggc agtgaccgga tatactgccg gaagcaccag tgtcaccttg   540
 541 cataattttt cccacgatag ctatttcgtg atgggaaatg tgggcaacgg cacgcgtgat   600
 601 aacgccgact cttcaaaaaa ctacggaaag gtgaaggaag acgtgtcgga aagcaattta   660
 661 ttaacgcata gctggacggc tgcgactaca gaaacttggg catactcatc ggctcccgga   720
 721 gctgaaaacc ggaagttgct ttgctcgttc tacacagccg aacgcctatt caagtcggat   780
 781 tattccgacc gactgtctat cagtatggct aatgtcctaa aagggccttc ggacgtcacc   840
 841 ggaataaccg ggaaagtaat tgaaagcgta acaaaggttg acggcacagg tagtccgaca   900
 901 gcgcaacctt ttacggagat ccgtcggaac aacgtgtatc aggtaacggc acgcgtagga   960
 961 aaaataggta ttcagatact gacgataagc gtagaagatt ggggtgaaag acaagacatt  1020
1021 gatttggata tggacttg  1038

Residues: 346 aa
Molecule Weight: 37460.80 Dalton
Number of Met residues: 8
Percentage of Met residues: 2.31 %
Number of Cys residues: 1
Percentage of Cys residues: 0.29 %

>SP17169A|1:370 tid:408606 alias: stage:proposed target Full|1:370 CP Pir/Fasta MRKKLLHIIYLASTILLFSCSREADVAYELPAHTTRAQLSIDLVNNGDVEQQEKINSMRF IVFGSTPGGVRLDVNEHILLSTPETATDIDAQLLEVTSSNDILVVVIANEPQSLTSQLDG IANLLTLQEMIYDISSILNSDGQIISATGMPMTGVIRDISIAPDETKTVQMVIERAVARV DVFIEAIDGGAVTGYTAGSTSVTLHNFSHDSYFVMGNVGNGTRDNADSSKNYGKVKEDVS ESNLLTHSWTAATTETWAYSSAPGAENRKLLCSFYTAERLFKSDYSDRLSISMANVLKGP SDVTGITGKVIESVTKVDGTGSPTAQPFTEIRRNNVYQVTARVGKIGIQILTISVEDWGE RQDIDLDMDL CDS cDNA 1110 bp 1 atgagaaaaa agctattaca tatcatttat ctggcatcca ccatcctttt gttctcatgt 60 61 agtagagaag ctgatgtggc ttatgagttg cctgcccata ctacccgggc gcaacttagc 120 121 atcgacttgg tgaacaatgg ggatgtggaa caacaggaga agataaactc catgcggttt 180 181 atcgtattcg gcagcacgcc cggtggcgtg aggctggatg tgaatgaaca catcctgttg 240 241 agcactccgg agacagctac tgatatagat gcgcaacttc tcgaagtgac ttccagcaat 300 301 gatatcctgg tcgtagttat tgccaacgaa ccgcagagtc tcacaagcca acttgacggt 360 361 atagctaatc ttttgacgtt gcaagagatg atttacgaca tctccagcat actgaatagt 420 421 gacgggcaga ttatttcggc gaccggaatg cctatgacag gagtgatccg ggatatatcc 480 481 atagcacccg atgaaaccaa aacagtgcaa atggtaatcg aacgtgccgt agcccgggta 540 541 gatgtcttta tcgaagctat agacggcggg gcagtgaccg gatatactgc cggaagcacc 600 601 agtgtcacct tgcataattt ttcccacgat agctatttcg tgatgggaaa tgtgggcaac 660 661 ggcacgcgtg ataacgccga ctcttcaaaa aactacggaa aggtgaagga agacgtgtcg 720 721 gaaagcaatt tattaacgca tagctggacg gctgcgacta cagaaacttg ggcatactca 780 781 tcggctcccg gagctgaaaa ccggaagttg ctttgctcgt tctacacagc cgaacgccta 840 841 ttcaagtcgg attattccga ccgactgtct atcagtatgg ctaatgtcct aaaagggcct 900 901 tcggacgtca ccggaataac cgggaaagta attgaaagcg taacaaaggt tgacggcaca 960 961 ggtagtccga cagcgcaacc ttttacggag atccgtcgga acaacgtgta tcaggtaacg 1020 1021 gcacgcgtag gaaaaatagg tattcagata ctgacgataa gcgtagaaga ttggggtgaa 1080 1081 agacaagaca ttgatttgga tatggacttg 1110 Residues: 370 aa Molecule Weight: 40250.06 Dalton Number of Met residues: 9 Percentage of Met residues: 2.43 % Number of Cys residues: 2 Percentage of Cys residues: 0.54 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu