LOADING...
   ZP_02066560.1;SP8524C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02066560.1    Target Constructs

Accession: ZP_02066560.1
Local acc: SP8524C
Description: gi|160885557|ref|ZP_02066560.1| hypothetical protein BACOVA_03559 [Bacteroides ovatus ATCC 8483]
Organism: Bacteroides ovatus
Residues: 380 aa
Constructs: 2
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>SP8524C|27:380 tid:416724 alias: stage:pdb deposition(pdb id:4DQA) fragment|27:380 CP Pir/Fasta
NDLLEPKVYFESKEYNFSVEDEMDVMTFDLVSRLSSATSSQVDVSYSVAEPSVVDEYNAK
YGTNYEMLDVSQVKLSSTTSSISSGKLYADNIEVELSGLEALKAGNSYVLPMRVHSSSVS
TLSGTNIAYFFFSKPLKITKAGNFSNHYISVKFPVGTFFSSFTYEALINVDYFLDNNTIM
GTEGVMILRIGDAGGGITPKDYLEVAGGQNYRVTKPLLTNRWYHVALTYDQPTGKTGIYV
NGEKWAGSDWGIDGFDPNSDMGFYIGRIYGFKWGERPFHGKMSEVRVWSVARTENQLKQN
MLGVDPASEGLALYYKLDGSETQEGGVIKDATGRINGTTNGITIKTLDAPIAIN
CDS  cDNA 1062 bp
   1 aatgacctgc tggagcctaa ggtttatttc gaaagcaagg aatataattt ctcggtggaa    60
  61 gatgaaatgg atgtaatgac atttgatctg gtttcaagac tctcgtcagc aacttcctct   120
 121 caggtagacg tatcatatag tgtagccgaa ccaagtgtag tagacgaata caatgcaaag   180
 181 tatggcacaa attatgagat gcttgatgtt tcgcaggtaa agctaagcag tacgacatct   240
 241 tctatttcga gtggaaaatt gtatgcggat aatatagaag tcgaactttc cgggttagaa   300
 301 gccttgaaag ccgggaactc atatgttttg cctatgcggg tgcattcgtc ttcggtgtcg   360
 361 actctttccg gaacaaacat tgcatatttc tttttctcca aaccgttgaa aattaccaaa   420
 421 gctggtaatt tcagtaacca ctatatttct gtgaagttcc ctgtcggtac tttcttctcg   480
 481 tcattcactt acgaagcatt gattaatgtg gattatttcc tcgataataa tacgattatg   540
 541 ggaaccgaag gtgtgatgat tctccgtatc ggtgatgcag gaggaggaat tactcctaaa   600
 601 gattatttgg aagtggccgg aggacagaac taccgtgtaa cgaaaccgtt gttaacaaat   660
 661 cgttggtatc atgtagcgtt gacttatgat caaccgacag gaaaaacagg tatttatgta   720
 721 aatggtgaga aatgggctgg ttcagattgg ggtattgacg gttttgatcc gaattcggac   780
 781 atgggttttt atattggtag aatctatggt tttaaatggg gtgaacgtcc attccatggt   840
 841 aaaatgagtg aagtccgtgt ttggagtgta gcccgtacgg aaaatcaact taagcagaat   900
 901 atgctgggtg ttgaccctgc ttcagaaggc ttggcacttt attataaact agacggatca   960
 961 gagactcagg aaggtggagt tatcaaagat gccacagggc gtataaacgg tactacaaat  1020
1021 ggaattacta ttaagacgtt ggatgctccg atagctatca at  1062

Residues: 354 aa
Molecule Weight: 39016.67 Dalton
Number of Met residues: 9
Percentage of Met residues: 2.54 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %

>SP8524C|1:380 tid:408069 alias: stage:proposed target Full|1:380 CP Pir/Fasta MMNKHIFYYLMVGSMALLLGACNDSMNDLLEPKVYFESKEYNFSVEDEMDVMTFDLVSRL SSATSSQVDVSYSVAEPSVVDEYNAKYGTNYEMLDVSQVKLSSTTSSISSGKLYADNIEV ELSGLEALKAGNSYVLPMRVHSSSVSTLSGTNIAYFFFSKPLKITKAGNFSNHYISVKFP VGTFFSSFTYEALINVDYFLDNNTIMGTEGVMILRIGDAGGGITPKDYLEVAGGQNYRVT KPLLTNRWYHVALTYDQPTGKTGIYVNGEKWAGSDWGIDGFDPNSDMGFYIGRIYGFKWG ERPFHGKMSEVRVWSVARTENQLKQNMLGVDPASEGLALYYKLDGSETQEGGVIKDATGR INGTTNGITIKTLDAPIAIN CDS cDNA 1140 bp 1 atgatgaata aacatatatt ctattatttg atggtaggta gtatggcgtt attgttgggc 60 61 gcttgcaacg acagcatgaa tgacctgctg gagcctaagg tttatttcga aagcaaggaa 120 121 tataatttct cggtggaaga tgaaatggat gtaatgacat ttgatctggt ttcaagactc 180 181 tcgtcagcaa cttcctctca ggtagacgta tcatatagtg tagccgaacc aagtgtagta 240 241 gacgaataca atgcaaagta tggcacaaat tatgagatgc ttgatgtttc gcaggtaaag 300 301 ctaagcagta cgacatcttc tatttcgagt ggaaaattgt atgcggataa tatagaagtc 360 361 gaactttccg ggttagaagc cttgaaagcc gggaactcat atgttttgcc tatgcgggtg 420 421 cattcgtctt cggtgtcgac tctttccgga acaaacattg catatttctt tttctccaaa 480 481 ccgttgaaaa ttaccaaagc tggtaatttc agtaaccact atatttctgt gaagttccct 540 541 gtcggtactt tcttctcgtc attcacttac gaagcattga ttaatgtgga ttatttcctc 600 601 gataataata cgattatggg aaccgaaggt gtgatgattc tccgtatcgg tgatgcagga 660 661 ggaggaatta ctcctaaaga ttatttggaa gtggccggag gacagaacta ccgtgtaacg 720 721 aaaccgttgt taacaaatcg ttggtatcat gtagcgttga cttatgatca accgacagga 780 781 aaaacaggta tttatgtaaa tggtgagaaa tgggctggtt cagattgggg tattgacggt 840 841 tttgatccga attcggacat gggtttttat attggtagaa tctatggttt taaatggggt 900 901 gaacgtccat tccatggtaa aatgagtgaa gtccgtgttt ggagtgtagc ccgtacggaa 960 961 aatcaactta agcagaatat gctgggtgtt gaccctgctt cagaaggctt ggcactttat 1020 1021 tataaactag acggatcaga gactcaggaa ggtggagtta tcaaagatgc cacagggcgt 1080 1081 ataaacggta ctacaaatgg aattactatt aagacgttgg atgctccgat agctatcaat 1140 Residues: 380 aa Molecule Weight: 41953.11 Dalton Number of Met residues: 14 Percentage of Met residues: 3.68 % Number of Cys residues: 1 Percentage of Cys residues: 0.26 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu