LOADING...
   ZP_02063319.1;SP13221C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02063319.1    Target Constructs

Accession: ZP_02063319.1
Local acc: SP13221C
Description: gi|160882316|ref|ZP_02063319.1| hypothetical protein BACOVA_00264 [Bacteroides ovatus ATCC 8483]
Organism: Bacteroides ovatus
Residues: 465 aa
Constructs: 2
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>SP13221C|34:465 tid:416762 alias: stage:pdb deposition(pdb id:4HW6) fragment|34:465 CP Pir/Fasta
STLDVNQDSGTPFNPKEEIVVEKFLPTEGRKGTRVVVYGRNFGNDVSKVKVTIGGYPAKV
INVKGESLLCICPSKAYEGDVKVSVVGDDEAELKSGVCEAKFDYQYNYVVTTFLGKLYEN
NTKWDVLAGPFDDCGAFDNIWRMMFDPNSNYDDLYWVGQRDAFRHVDFVNQYVDIKTTNI
GQCADVNFTLNGDMVVVDDQSSDTNTGIYLFTRASGFTERLSLCNARGAKTCAVHPQNGK
IYYTRYHHAMISSYDPATGTLTEEEVMMDTKGSNFHIVWHPTGDWAYIIYNGKHCIYRVD
YNRETGKLAVPYIVCGQHSSPGWVDGMGTGARLWGPNQGIFVKNEAYAGEEDEYDFYFCD
RDSHTVRVLTPEGRVTTYAGRGNSREWGYVDGELRSQALFNHPTSIAYDMKRKCFYIGDC
DNHRVRKIAPEE
CDS  cDNA 1296 bp
   1 agtaccttgg atgtaaatca ggattcgggt actccgttca atcctaaaga ggagattgta    60
  61 gtagagaagt ttctgcctac cgaggggcgt aaagggactc gtgtagtggt atatggccga   120
 121 aatttcggta acgacgtgag taaagtaaaa gttacgattg gcggctatcc cgccaaagtt   180
 181 atcaatgtaa agggcgaatc gttgctttgc atttgtccat cgaaagctta tgaaggagat   240
 241 gtaaaagtct ctgttgttgg tgatgacgag gctgagctga agagcggtgt gtgtgaagcc   300
 301 aagtttgatt accaatataa ttatgtggta accaccttct tgggcaaact ttatgagaac   360
 361 aataccaaat gggatgtgct ggccggtccg tttgacgatt gtggtgcatt tgacaacatt   420
 421 tggcgcatga tgttcgatcc taacagcaat tatgatgacc tctattgggt tggtcagaga   480
 481 gatgctttcc gtcatgtgga tttcgtgaat caatatgtag atatcaaaac taccaatatt   540
 541 gggcaatgcg cagatgtgaa ctttacgctt aatggcgata tggtagtggt ggacgatcaa   600
 601 agttcggata caaataccgg tatttatctg tttacccgtg ccagtgggtt taccgaacgt   660
 661 ttgtctcttt gtaatgctcg tggagcaaag acgtgtgccg ttcatcccca aaatggaaaa   720
 721 atctattata cacgttatca ccatgctatg atatcatctt acgatccggc tacaggcacg   780
 781 ttgactgaag aggaggtaat gatggatact aaaggctcaa acttccacat cgtttggcat   840
 841 cccacaggtg actgggctta catcatctac aatggcaaac attgcatcta tcgtgtggat   900
 901 tataatagag aaaccggaaa attggctgtt ccctatattg tatgcggaca acatagtagc   960
 961 ccaggatggg ttgacggaat gggcacaggt gcacggttgt gggggccaaa ccaaggtatt  1020
1021 ttcgtgaaga atgaagctta tgccggcgaa gaggatgaat acgacttcta cttctgcgat  1080
1081 cgtgatagcc atactgttcg tgttctcaca cccgaaggtc gtgtgacaac ctacgctggt  1140
1141 cgcggtaata gccgtgaatg gggttatgtg gatggagaac ttcgctctca agcactcttc  1200
1201 aatcatccca ccagtatcgc ttacgacatg aaacgtaagt gtttttatat cggtgactgc  1260
1261 gacaaccatc gcgtacgcaa aattgcgccg gaagaa  1296

Residues: 432 aa
Molecule Weight: 48758.99 Dalton
Number of Met residues: 8
Percentage of Met residues: 1.85 %
Number of Cys residues: 12
Percentage of Cys residues: 2.78 %

>SP13221C|1:465 tid:408149 alias: stage:proposed target Full|1:465 CP Pir/Fasta MIQVTRRHVFSKALLQKTLFVAGLVLFSSCYKGSTLDVNQDSGTPFNPKEEIVVEKFLPT EGRKGTRVVVYGRNFGNDVSKVKVTIGGYPAKVINVKGESLLCICPSKAYEGDVKVSVVG DDEAELKSGVCEAKFDYQYNYVVTTFLGKLYENNTKWDVLAGPFDDCGAFDNIWRMMFDP NSNYDDLYWVGQRDAFRHVDFVNQYVDIKTTNIGQCADVNFTLNGDMVVVDDQSSDTNTG IYLFTRASGFTERLSLCNARGAKTCAVHPQNGKIYYTRYHHAMISSYDPATGTLTEEEVM MDTKGSNFHIVWHPTGDWAYIIYNGKHCIYRVDYNRETGKLAVPYIVCGQHSSPGWVDGM GTGARLWGPNQGIFVKNEAYAGEEDEYDFYFCDRDSHTVRVLTPEGRVTTYAGRGNSREW GYVDGELRSQALFNHPTSIAYDMKRKCFYIGDCDNHRVRKIAPEE CDS cDNA 1395 bp 1 atgatacagg ttacaagacg acatgtattt tctaaagcgt tgctgcagaa gacattattt 60 61 gtggcgggct tagtcctttt ttcttcttgt tacaagggca gtaccttgga tgtaaatcag 120 121 gattcgggta ctccgttcaa tcctaaagag gagattgtag tagagaagtt tctgcctacc 180 181 gaggggcgta aagggactcg tgtagtggta tatggccgaa atttcggtaa cgacgtgagt 240 241 aaagtaaaag ttacgattgg cggctatccc gccaaagtta tcaatgtaaa gggcgaatcg 300 301 ttgctttgca tttgtccatc gaaagcttat gaaggagatg taaaagtctc tgttgttggt 360 361 gatgacgagg ctgagctgaa gagcggtgtg tgtgaagcca agtttgatta ccaatataat 420 421 tatgtggtaa ccaccttctt gggcaaactt tatgagaaca ataccaaatg ggatgtgctg 480 481 gccggtccgt ttgacgattg tggtgcattt gacaacattt ggcgcatgat gttcgatcct 540 541 aacagcaatt atgatgacct ctattgggtt ggtcagagag atgctttccg tcatgtggat 600 601 ttcgtgaatc aatatgtaga tatcaaaact accaatattg ggcaatgcgc agatgtgaac 660 661 tttacgctta atggcgatat ggtagtggtg gacgatcaaa gttcggatac aaataccggt 720 721 atttatctgt ttacccgtgc cagtgggttt accgaacgtt tgtctctttg taatgctcgt 780 781 ggagcaaaga cgtgtgccgt tcatccccaa aatggaaaaa tctattatac acgttatcac 840 841 catgctatga tatcatctta cgatccggct acaggcacgt tgactgaaga ggaggtaatg 900 901 atggatacta aaggctcaaa cttccacatc gtttggcatc ccacaggtga ctgggcttac 960 961 atcatctaca atggcaaaca ttgcatctat cgtgtggatt ataatagaga aaccggaaaa 1020 1021 ttggctgttc cctatattgt atgcggacaa catagtagcc caggatgggt tgacggaatg 1080 1081 ggcacaggtg cacggttgtg ggggccaaac caaggtattt tcgtgaagaa tgaagcttat 1140 1141 gccggcgaag aggatgaata cgacttctac ttctgcgatc gtgatagcca tactgttcgt 1200 1201 gttctcacac ccgaaggtcg tgtgacaacc tacgctggtc gcggtaatag ccgtgaatgg 1260 1261 ggttatgtgg atggagaact tcgctctcaa gcactcttca atcatcccac cagtatcgct 1320 1321 tacgacatga aacgtaagtg tttttatatc ggtgactgcg acaaccatcg cgtacgcaaa 1380 1381 attgcgccgg aagaa 1395 Residues: 465 aa Molecule Weight: 52483.33 Dalton Number of Met residues: 9 Percentage of Met residues: 1.94 % Number of Cys residues: 13 Percentage of Cys residues: 2.80 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu