LOADING...
   ZP_02043836.1;SP17439A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02043836.1    Target Constructs

Accession: ZP_02043836.1
Local acc: SP17439A
Description: gi|154508194|ref|ZP_02043836.1| hypothetical protein ACTODO_00688 [Actinomyces odontolyticus ATCC 17982]
Organism: ACTINOMYCES ODONTOLYTICUS ATCC 17982
Residues: 352 aa
Constructs: 2
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>SP17439A|22:352 tid:419866 alias: stage:pdb deposition(pdb id:5BQ3) fragment|22:352 CP Pir/Fasta
CGGGTSTQGSESSSGGDASGSYDVSSQSITFIPKQLNNPFSDVMLGGGKNAAGEIGFAEV
NVVGPLEASSSSQVSFINSEVQAGTNVLVIAANDPDAVCPALQDARKAGTKVVTFDSDSA
ADCRDLFINQVESKQVAITMLDMVSDQIGGSGKVAILSATANAANQNAWIKFMEDEIASN
DKYKGIEIVAKVYGDDDDTKSFQEAQGLLQAHPDLNAIVSPTTVGIAATARYLSTSDYKG
KVFLTGLGLPNEMRSFVKDGTVKEFALWDPAQLGYVAAYAGAALDSGAIKGEVGEKFTAG
NLGERTIGENKTVVVGDPVRFNADNIDKYDF
CDS  cDNA 993 bp
   1 tgtggcggtg gaacgtcgac gcagggcagt gagtccagtt ccggcggcga tgcctccggt    60
  61 tcgtacgatg tttcgtccca gtcgattacg tttatcccca agcagctgaa caacccgttc   120
 121 tccgacgtca tgctcggcgg cggcaagaac gctgcgggcg agatcggctt cgccgaggtc   180
 181 aacgtcgtcg gtccgctcga ggcgtcctcc tcctcgcagg tctccttcat caactccgag   240
 241 gtgcaggcag gcacgaacgt cctcgtgatc gccgcgaatg accccgatgc cgtatgccct   300
 301 gcgcttcagg atgcgcgcaa ggccggtaca aaggtcgtca ccttcgactc cgacagcgcg   360
 361 gccgattgcc gagacctgtt catcaaccag gttgaatcca agcaggttgc aatcaccatg   420
 421 ctcgacatgg tctctgacca gatcggcggt tccggtaagg tagccatcct ctctgcgacg   480
 481 gcgaacgccg ccaaccagaa cgcgtggatc aagttcatgg aggatgagat cgcctcgaac   540
 541 gacaagtaca agggcattga gatcgtcgcg aaggtctatg gcgatgacga tgacacgaag   600
 601 tcgttccagg aggcgcaggg cctgctccag gctcaccccg accttaatgc gatcgtctcc   660
 661 ccgaccaccg tcggtatcgc cgccaccgct cgctacctgt cgacctctga ctacaagggc   720
 721 aaggtcttcc tgaccggcct gggtctgccg aacgaaatgc gttccttcgt gaaggatgga   780
 781 accgtcaagg agtttgccct gtgggatccc gcccagctag gatacgtggc cgcatacgcg   840
 841 ggtgcagcgc tcgatagtgg tgcgatcaag ggcgaggtag gggagaagtt cactgccgga   900
 901 aacctcggtg aacgcacgat cggcgagaac aagaccgtcg tcgtcggtga ccccgtgcgc   960
 961 ttcaacgcgg acaacatcga caagtacgac ttc   993

Residues: 331 aa
Molecule Weight: 34484.31 Dalton
Number of Met residues: 5
Percentage of Met residues: 1.51 %
Number of Cys residues: 3
Percentage of Cys residues: 0.91 %

>SP17439A|1:352 tid:406568 alias: stage:proposed target Full|1:352 CP Pir/Fasta MKKGVAALGALSLTSALLMSACGGGTSTQGSESSSGGDASGSYDVSSQSITFIPKQLNNP FSDVMLGGGKNAAGEIGFAEVNVVGPLEASSSSQVSFINSEVQAGTNVLVIAANDPDAVC PALQDARKAGTKVVTFDSDSAADCRDLFINQVESKQVAITMLDMVSDQIGGSGKVAILSA TANAANQNAWIKFMEDEIASNDKYKGIEIVAKVYGDDDDTKSFQEAQGLLQAHPDLNAIV SPTTVGIAATARYLSTSDYKGKVFLTGLGLPNEMRSFVKDGTVKEFALWDPAQLGYVAAY AGAALDSGAIKGEVGEKFTAGNLGERTIGENKTVVVGDPVRFNADNIDKYDF CDS cDNA 1056 bp 1 atgaagaaag gtgtggccgc acttggcgca ctctcgctga cctcggccct cctgatgtcc 60 61 gcctgtggcg gtggaacgtc gacgcagggc agtgagtcca gttccggcgg cgatgcctcc 120 121 ggttcgtacg atgtttcgtc ccagtcgatt acgtttatcc ccaagcagct gaacaacccg 180 181 ttctccgacg tcatgctcgg cggcggcaag aacgctgcgg gcgagatcgg cttcgccgag 240 241 gtcaacgtcg tcggtccgct cgaggcgtcc tcctcctcgc aggtctcctt catcaactcc 300 301 gaggtgcagg caggcacgaa cgtcctcgtg atcgccgcga atgaccccga tgccgtatgc 360 361 cctgcgcttc aggatgcgcg caaggccggt acaaaggtcg tcaccttcga ctccgacagc 420 421 gcggccgatt gccgagacct gttcatcaac caggttgaat ccaagcaggt tgcaatcacc 480 481 atgctcgaca tggtctctga ccagatcggc ggttccggta aggtagccat cctctctgcg 540 541 acggcgaacg ccgccaacca gaacgcgtgg atcaagttca tggaggatga gatcgcctcg 600 601 aacgacaagt acaagggcat tgagatcgtc gcgaaggtct atggcgatga cgatgacacg 660 661 aagtcgttcc aggaggcgca gggcctgctc caggctcacc ccgaccttaa tgcgatcgtc 720 721 tccccgacca ccgtcggtat cgccgccacc gctcgctacc tgtcgacctc tgactacaag 780 781 ggcaaggtct tcctgaccgg cctgggtctg ccgaacgaaa tgcgttcctt cgtgaaggat 840 841 ggaaccgtca aggagtttgc cctgtgggat cccgcccagc taggatacgt ggccgcatac 900 901 gcgggtgcag cgctcgatag tggtgcgatc aagggcgagg taggggagaa gttcactgcc 960 961 ggaaacctcg gtgaacgcac gatcggcgag aacaagaccg tcgtcgtcgg tgaccccgtg 1020 1021 cgcttcaacg cggacaacat cgacaagtac gacttc 1056 Residues: 352 aa Molecule Weight: 36499.67 Dalton Number of Met residues: 7 Percentage of Met residues: 1.99 % Number of Cys residues: 3 Percentage of Cys residues: 0.85 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu