LOADING...
   ZP_02040096.1;SP17422C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02040096.1    Target Constructs

Accession: ZP_02040096.1
Local acc: SP17422C
Description: gi|154503036|ref|ZP_02040096.1| hypothetical protein RUMGNA_00858 [Ruminococcus gnavus ATCC 29149]
Organism: Ruminococcus gnavus ATCC 29149
Residues: 278 aa
Constructs: 2
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>SP17422C|28:278 tid:416853 alias: stage:pdb deposition(pdb id:4IB2) fragment|28:278 CP Pir/Fasta
EEKGSSEDAKTIKVAASATPHAEILEQAKSILKKEGYQLEVTVFDDYVQPNEVVESGEFD
ANYFQHVPYLESFNEEKGTHLVDAGDIHYEPFGIYPGTKKSLDEISEGDKIAVPNDTTNE
ARALLLLQDNGIITLKDGAGLNATVNDIEENPYNVEIVELEAAQVARVTGETAYVVLNGN
YALEAGYSVAKDALAYEKSDSEAAKTYVNIIAVKEGNEKEEKIQALVKALKSDEIKEYIE
KTYDGAVIPFE
CDS  cDNA 753 bp
   1 gaggagaaag gcagcagtga agatgcaaag acgattaaag tagcagcatc tgcaactcca    60
  61 cacgctgaaa tattggaaca ggcaaaatcg attctgaaaa aagaaggata tcagctggaa   120
 121 gtgacagtgt ttgatgacta tgtgcagcca aatgaagttg tagagagcgg agaatttgat   180
 181 gcaaactatt tccagcatgt gccatatctg gaaagtttca acgaggaaaa aggaactcat   240
 241 ctggtagatg caggagatat ccattatgag ccatttggaa tttatccagg aacaaaaaag   300
 301 agtctggatg aaatttccga aggtgataaa atcgcagtgc caaatgatac gacaaatgaa   360
 361 gccagagcat tgcttctctt acaggacaat ggaattatca cattaaaaga cggggcagga   420
 421 ctcaatgcaa cagtaaatga tattgaagaa aatccatata atgtagaaat tgtagaactg   480
 481 gaagctgcac aggtagcaag agtgaccgga gaaactgcat atgtagtact aaatggaaac   540
 541 tatgcgctgg aagcaggata ttctgtagcc aaagatgcgc ttgcatatga aaaatcagat   600
 601 tctgaggctg caaaaacata tgtaaacatt attgcagtaa aagagggaaa tgaaaaagag   660
 661 gaaaagatac aggctcttgt aaaggcattg aaatcagatg agattaaaga atatatcgaa   720
 721 aaaacctatg acggagctgt gattcctttt gaa   753

Residues: 251 aa
Molecule Weight: 27544.00 Dalton
Number of Met residues: 0
Percentage of Met residues: 0.00 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %

>SP17422C|1:278 tid:413499 alias: stage:proposed target Full|1:278 CP Pir/Fasta MKKVTAIILTGILTLGVLTGCQSNSKAEEKGSSEDAKTIKVAASATPHAEILEQAKSILK KEGYQLEVTVFDDYVQPNEVVESGEFDANYFQHVPYLESFNEEKGTHLVDAGDIHYEPFG IYPGTKKSLDEISEGDKIAVPNDTTNEARALLLLQDNGIITLKDGAGLNATVNDIEENPY NVEIVELEAAQVARVTGETAYVVLNGNYALEAGYSVAKDALAYEKSDSEAAKTYVNIIAV KEGNEKEEKIQALVKALKSDEIKEYIEKTYDGAVIPFE CDS cDNA 834 bp 1 atgaaaaagg taacagcaat tatattaaca gggatcttaa cattaggagt actgacagga 60 61 tgccaaagta attcaaaagc agaggagaaa ggcagcagtg aagatgcaaa gacgattaaa 120 121 gtagcagcat ctgcaactcc acacgctgaa atattggaac aggcaaaatc gattctgaaa 180 181 aaagaaggat atcagctgga agtgacagtg tttgatgact atgtgcagcc aaatgaagtt 240 241 gtagagagcg gagaatttga tgcaaactat ttccagcatg tgccatatct ggaaagtttc 300 301 aacgaggaaa aaggaactca tctggtagat gcaggagata tccattatga gccatttgga 360 361 atttatccag gaacaaaaaa gagtctggat gaaatttccg aaggtgataa aatcgcagtg 420 421 ccaaatgata cgacaaatga agccagagca ttgcttctct tacaggacaa tggaattatc 480 481 acattaaaag acggggcagg actcaatgca acagtaaatg atattgaaga aaatccatat 540 541 aatgtagaaa ttgtagaact ggaagctgca caggtagcaa gagtgaccgg agaaactgca 600 601 tatgtagtac taaatggaaa ctatgcgctg gaagcaggat attctgtagc caaagatgcg 660 661 cttgcatatg aaaaatcaga ttctgaggct gcaaaaacat atgtaaacat tattgcagta 720 721 aaagagggaa atgaaaaaga ggaaaagata caggctcttg taaaggcatt gaaatcagat 780 781 gagattaaag aatatatcga aaaaacctat gacggagctg tgattccttt tgaa 834 Residues: 278 aa Molecule Weight: 30287.20 Dalton Number of Met residues: 1 Percentage of Met residues: 0.36 % Number of Cys residues: 1 Percentage of Cys residues: 0.36 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu