LOADING...
   ZP_02032405.1;SP13677A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02032405.1    Target Constructs

Accession: ZP_02032405.1
Local acc: SP13677A
Description: gi|154492779|ref|ZP_02032405.1| hypothetical protein PARMER_02418 [Parabacteroides merdae ATCC 43184]
Organism: Parabacteroides merdae
Residues: 304 aa
Constructs: 2
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>SP13677A|25:304 tid:419184 alias: stage:pdb deposition(pdb id:4E5V) fragment|25:304 CP Pir/Fasta
RKPIKTLLITGQNNHNWQVSHVVLKQILENSGRFDVDFVISPEQGKDMSGFVLDFSPYQL
VVLDYNGDSWPEETNRRFLEYVQNGGGVVIYHAADNAFSKWPEFNRICALGGWEGRNENS
GPYVYWKDGKLVKDSSAGPGGSHGRQHEYVLNGRDKVHPVVKGLPLKWRHAKDELYDRMR
GPGNIRDILYTAYSDKETNGSGREEPLVFTVDYGNARIFHTMLGHAGATTEDNIAMQCTG
FQVLLLRGAEWAATGKVTQKVPKDFPTETTCSYRKDYKEN
CDS  cDNA 840 bp
   1 cgtaaaccga ttaaaacatt actgatcaca ggacaaaaca accataactg gcaggtgagc    60
  61 catgttgtgc tgaaacaaat cctggaaaat tccggtcgtt ttgatgtgga ctttgtcatc   120
 121 tctcccgaac agggcaagga tatgtccggt tttgtgctcg actttagccc ttaccagttg   180
 181 gtagtgctgg actataacgg agattcgtgg ccggaggaga cgaaccgccg cttcctggaa   240
 241 tatgtgcaga acggcggtgg tgttgtcatt tatcatgcag ccgacaatgc tttctccaaa   300
 301 tggccggagt tcaataggat ctgtgctttg ggtggttggg aaggacgtaa tgagaattcc   360
 361 ggcccttatg tgtattggaa ggacggaaaa ctggtcaagg acagttcggc gggtccgggt   420
 421 ggttctcatg gacgccagca cgaatatgtg ctgaacgggc gtgacaaggt gcatccggtt   480
 481 gtgaagggcc tgcctttaaa atggcgtcat gccaaagatg aactttacga ccgtatgcgg   540
 541 ggaccgggca atatccggga tattttgtac acggcctatt cggataagga aacaaacggt   600
 601 tccggtcgtg aagaaccgct ggtatttacg gtcgattacg ggaatgctcg catcttccat   660
 661 acgatgcttg gccatgccgg tgctactacg gaagataata tagcaatgca atgtacgggc   720
 721 ttccaggtgc ttttgcttcg tggcgccgaa tgggcggcaa ccggaaaagt aacccagaaa   780
 781 gtcccgaaag atttcccgac ggagactact tgttcttatc ggaaagatta taaggagaat   840

Residues: 280 aa
Molecule Weight: 31645.93 Dalton
Number of Met residues: 4
Percentage of Met residues: 1.43 %
Number of Cys residues: 3
Percentage of Cys residues: 1.07 %

>SP13677A|1:304 tid:412869 alias: stage:proposed target Full|1:304 CP Pir/Fasta MRHLHFGKLFFVVFSLLLAYTVSARKPIKTLLITGQNNHNWQVSHVVLKQILENSGRFDV DFVISPEQGKDMSGFVLDFSPYQLVVLDYNGDSWPEETNRRFLEYVQNGGGVVIYHAADN AFSKWPEFNRICALGGWEGRNENSGPYVYWKDGKLVKDSSAGPGGSHGRQHEYVLNGRDK VHPVVKGLPLKWRHAKDELYDRMRGPGNIRDILYTAYSDKETNGSGREEPLVFTVDYGNA RIFHTMLGHAGATTEDNIAMQCTGFQVLLLRGAEWAATGKVTQKVPKDFPTETTCSYRKD YKEN CDS cDNA 912 bp 1 atgagacatt tacattttgg gaagctgttt tttgttgtct tttccctctt gttagcctat 60 61 acggtttcgg cgcgtaaacc gattaaaaca ttactgatca caggacaaaa caaccataac 120 121 tggcaggtga gccatgttgt gctgaaacaa atcctggaaa attccggtcg ttttgatgtg 180 181 gactttgtca tctctcccga acagggcaag gatatgtccg gttttgtgct cgactttagc 240 241 ccttaccagt tggtagtgct ggactataac ggagattcgt ggccggagga gacgaaccgc 300 301 cgcttcctgg aatatgtgca gaacggcggt ggtgttgtca tttatcatgc agccgacaat 360 361 gctttctcca aatggccgga gttcaatagg atctgtgctt tgggtggttg ggaaggacgt 420 421 aatgagaatt ccggccctta tgtgtattgg aaggacggaa aactggtcaa ggacagttcg 480 481 gcgggtccgg gtggttctca tggacgccag cacgaatatg tgctgaacgg gcgtgacaag 540 541 gtgcatccgg ttgtgaaggg cctgccttta aaatggcgtc atgccaaaga tgaactttac 600 601 gaccgtatgc ggggaccggg caatatccgg gatattttgt acacggccta ttcggataag 660 661 gaaacaaacg gttccggtcg tgaagaaccg ctggtattta cggtcgatta cgggaatgct 720 721 cgcatcttcc atacgatgct tggccatgcc ggtgctacta cggaagataa tatagcaatg 780 781 caatgtacgg gcttccaggt gcttttgctt cgtggcgccg aatgggcggc aaccggaaaa 840 841 gtaacccaga aagtcccgaa agatttcccg acggagacta cttgttctta tcggaaagat 900 901 tataaggaga at 912 Residues: 304 aa Molecule Weight: 34425.17 Dalton Number of Met residues: 5 Percentage of Met residues: 1.64 % Number of Cys residues: 3 Percentage of Cys residues: 0.99 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu