LOADING...
   ZP_02030716.1;SP16962B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02030716.1    Target Constructs

Accession: ZP_02030716.1
Local acc: SP16962B
Description: gi|154490775|ref|ZP_02030716.1| hypothetical protein PARMER_00689 [Parabacteroides merdae ATCC 43184]
Organism: Parabacteroides merdae
Residues: 256 aa
Constructs: 2
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>SP16962B|29:256 tid:419167 alias: stage:pdb deposition(pdb id:4Q9A) fragment|29:256 CP Pir/Fasta
AVKENTSVHAPKINLKKDCVILFQGDSITDCGRDRNSNRCNTMEQFGSGYVLFTATQLLE
GKAALQPKIYNRGISGNKVYQLRERWEIDCLAFQPDVLSILIGVNDYWHTLTHGYKGTVE
TYENDLRALLKYTKEKLPNTQIVLCEPFTLRDGAAIEDSKWYPMFDEFRKSARKLSEEFN
TIFVPFQSGFDAAVKLAPARYWSNDGVHPDLPGRQLMANMWMEATGLK
CDS  cDNA 684 bp
   1 gctgttaaag aaaatacatc cgtacatgct ccgaagatta atctgaaaaa ggattgtgtg    60
  61 atcctgttcc agggagattc catcacggac tgcggtcgcg acaggaatag taaccgttgc   120
 121 aatacgatgg aacaattcgg tagtggctat gtgctcttta ccgctacgca gttgttggag   180
 181 gggaaagcgg ctttgcagcc gaagatttac aatcgcggca tcagcggcaa taaagtctat   240
 241 caacttcgtg aacgctggga gatcgactgt cttgctttcc agccggatgt cctgagcatc   300
 301 ctgatcggtg tgaatgatta ttggcatacg ttgacgcatg gttataaagg aacggtcgag   360
 361 acatacgaaa acgatctgcg tgctttgttg aaatatacga aagagaaact cccgaatacg   420
 421 caaatagtcc tttgcgaacc cttcactttg cgtgacgggg cggctataga agattccaaa   480
 481 tggtatccga tgttcgatga attccgcaag tctgcccgta aactgtcgga agaattcaat   540
 541 accatattcg ttcccttcca atcgggtttc gatgcagcgg tgaagctggc tccggcacgt   600
 601 tattggtcga atgacggtgt gcatcccgat ttacccggtc gccagctgat ggcaaacatg   660
 661 tggatggaag cgactggatt aaag   684

Residues: 228 aa
Molecule Weight: 25997.29 Dalton
Number of Met residues: 5
Percentage of Met residues: 2.19 %
Number of Cys residues: 5
Percentage of Cys residues: 2.19 %

>SP16962B|1:256 tid:412823 alias: stage:proposed target Full|1:256 CP Pir/Fasta MKNSRRDFLKKGALAGFSALMIPEIAKAAVKENTSVHAPKINLKKDCVILFQGDSITDCG RDRNSNRCNTMEQFGSGYVLFTATQLLEGKAALQPKIYNRGISGNKVYQLRERWEIDCLA FQPDVLSILIGVNDYWHTLTHGYKGTVETYENDLRALLKYTKEKLPNTQIVLCEPFTLRD GAAIEDSKWYPMFDEFRKSARKLSEEFNTIFVPFQSGFDAAVKLAPARYWSNDGVHPDLP GRQLMANMWMEATGLK CDS cDNA 768 bp 1 atgaagaatt ccagaagaga cttccttaaa aagggagcgt tggcagggtt cagtgccctg 60 61 atgatcccgg agatcgcaaa agccgctgtt aaagaaaata catccgtaca tgctccgaag 120 121 attaatctga aaaaggattg tgtgatcctg ttccagggag attccatcac ggactgcggt 180 181 cgcgacagga atagtaaccg ttgcaatacg atggaacaat tcggtagtgg ctatgtgctc 240 241 tttaccgcta cgcagttgtt ggaggggaaa gcggctttgc agccgaagat ttacaatcgc 300 301 ggcatcagcg gcaataaagt ctatcaactt cgtgaacgct gggagatcga ctgtcttgct 360 361 ttccagccgg atgtcctgag catcctgatc ggtgtgaatg attattggca tacgttgacg 420 421 catggttata aaggaacggt cgagacatac gaaaacgatc tgcgtgcttt gttgaaatat 480 481 acgaaagaga aactcccgaa tacgcaaata gtcctttgcg aacccttcac tttgcgtgac 540 541 ggggcggcta tagaagattc caaatggtat ccgatgttcg atgaattccg caagtctgcc 600 601 cgtaaactgt cggaagaatt caataccata ttcgttccct tccaatcggg tttcgatgca 660 661 gcggtgaagc tggctccggc acgttattgg tcgaatgacg gtgtgcatcc cgatttaccc 720 721 ggtcgccagc tgatggcaaa catgtggatg gaagcgactg gattaaag 768 Residues: 256 aa Molecule Weight: 29043.79 Dalton Number of Met residues: 7 Percentage of Met residues: 2.73 % Number of Cys residues: 5 Percentage of Cys residues: 1.95 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu