LOADING...
   ZP_02030627.1;SP0437A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02030627.1    Target Constructs

Accession: ZP_02030627.1
Local acc: SP0437A
Description: gi|154490366|ref|ZP_02030627.1| hypothetical protein PARMER_00599 [Parabacteroides merdae ATCC 43184]
Organism: Parabacteroides merdae
Residues: 250 aa
Constructs: 2
Construct alignments            CP: Chemical properties   Pir/Fasta: sequences in Pir and/or Fasta format
>SP0437A|23:250 tid:418199 alias: stage:pdb deposition(pdb id:4MXN) fragment|23:250 CP Pir/Fasta
KDYQVAMFGIKSDGVTLNTRSIQRAVDYISEQGGGRLIFYVGRYLTGSIELKSNVTIRIE
EGAVLVAVPSVYDFKGVGGCNAIIYADKQKNIGIGGKGIIDGRSIAVRASVEEQLQKGHI
EGNVSDYAPALICMEGCEDVKIEQVTLQDAANVAEIYKDCHNVTVDKVVVNAGASDRKAI
SISGCDGVKMTDCYFNMAGNPLESAGTSRNLIFTNCITPDGKAVSSDQ
CDS  cDNA 684 bp
   1 aaagattacc aagtcgcgat gtttggaatc aaatcggacg gagtgacact caatacccgt    60
  61 tctatccagc gagctgtcga ttatatcagt gaacagggag gcggccggct tattttttat   120
 121 gtgggccgtt atctgactgg ttcaatcgaa cttaagtcga atgtgacgat ccgtatcgaa   180
 181 gagggagccg tcttggttgc agttccctcc gtttatgatt ttaaaggggt tggaggatgt   240
 241 aatgcgatta tttacgcaga caagcaaaag aatatcggta tcggtggaaa aggcattatc   300
 301 gatggccgta gcatcgctgt gcgggcaagc gtggaagagc aattgcaaaa agggcatatc   360
 361 gaaggaaatg tatccgatta tgcaccagct ttgatctgca tggaaggctg cgaggatgtg   420
 421 aaaatcgaac aagtcaccct gcaggatgca gcgaacgtag ccgaaatata taaggactgc   480
 481 cataatgtga cagtcgacaa agtcgttgtg aatgccggtg catcggaccg gaaagcaatc   540
 541 tcgatttccg gctgtgacgg agtgaagatg acagattgct actttaatat ggcggggaat   600
 601 ccgttggaga gtgctgggac atcccgtaat ctaatattta caaattgtat aacaccagac   660
 661 ggcaaagctg tctcaagcga tcaa   684

Residues: 228 aa
Molecule Weight: 24326.25 Dalton
Number of Met residues: 4
Percentage of Met residues: 1.75 %
Number of Cys residues: 7
Percentage of Cys residues: 3.07 %

>SP0437A|1:250 tid:412983 alias: stage:proposed target Full|1:250 CP Pir/Fasta MNKNKLFASVIGLLVFVAGLSAKDYQVAMFGIKSDGVTLNTRSIQRAVDYISEQGGGRLI FYVGRYLTGSIELKSNVTIRIEEGAVLVAVPSVYDFKGVGGCNAIIYADKQKNIGIGGKG IIDGRSIAVRASVEEQLQKGHIEGNVSDYAPALICMEGCEDVKIEQVTLQDAANVAEIYK DCHNVTVDKVVVNAGASDRKAISISGCDGVKMTDCYFNMAGNPLESAGTSRNLIFTNCIT PDGKAVSSDQ CDS cDNA 750 bp 1 atgaataaaa ataaattatt tgcaagtgtg ataggccttt tggtctttgt ggcgggactt 60 61 tcagctaaag attaccaagt cgcgatgttt ggaatcaaat cggacggagt gacactcaat 120 121 acccgttcta tccagcgagc tgtcgattat atcagtgaac agggaggcgg ccggcttatt 180 181 ttttatgtgg gccgttatct gactggttca atcgaactta agtcgaatgt gacgatccgt 240 241 atcgaagagg gagccgtctt ggttgcagtt ccctccgttt atgattttaa aggggttgga 300 301 ggatgtaatg cgattattta cgcagacaag caaaagaata tcggtatcgg tggaaaaggc 360 361 attatcgatg gccgtagcat cgctgtgcgg gcaagcgtgg aagagcaatt gcaaaaaggg 420 421 catatcgaag gaaatgtatc cgattatgca ccagctttga tctgcatgga aggctgcgag 480 481 gatgtgaaaa tcgaacaagt caccctgcag gatgcagcga acgtagccga aatatataag 540 541 gactgccata atgtgacagt cgacaaagtc gttgtgaatg ccggtgcatc ggaccggaaa 600 601 gcaatctcga tttccggctg tgacggagtg aagatgacag attgctactt taatatggcg 660 661 gggaatccgt tggagagtgc tgggacatcc cgtaatctaa tatttacaaa ttgtataaca 720 721 ccagacggca aagctgtctc aagcgatcaa 750 Residues: 250 aa Molecule Weight: 26600.91 Dalton Number of Met residues: 5 Percentage of Met residues: 2.00 % Number of Cys residues: 7 Percentage of Cys residues: 2.80 %


Notes: A protein target may have more than one constructs. Every construct has its unique target id. It can be identified by alias if available, otherwise by local accession with start and end positions. This list of constructs is sorted by stage in desc order.

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).
Contact Webmaster JCSG Menu